PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_5372_f_12
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HB-other
Protein Properties Length: 195aa    MW: 22883.3 Da    PI: 6.7798
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_5372_f_12genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.51.2e-091221572055
                     HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  Neem_5372_f_12 122 YKWPYPSETEKLALAESTGLDQKQINNWFINQRKRH 157
                     5679*****************************885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007113.00597160IPR001356Homeobox domain
SuperFamilySSF466892.52E-2098172IPR009057Homeodomain-like
SMARTSM003891.5E-1299164IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.9E-28102163IPR009057Homeodomain-like
CDDcd000867.77E-13109161No hitNo description
PfamPF059209.8E-17117156IPR008422Homeobox KN domain
PROSITE patternPS000270135158IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MWEMPYKRII RFAILCALGC WVVMTHSKMN YLICITNLCY GQVLMLQFMH FFFDNLTDEK  60
CEGVGSSEED QDNSGGEAEL PEIDPRAEDR ELKNTPLSKK KKKGKLPKEA RQKLLSWWEL  120
HYKWPYPSET EKLALAESTG LDQKQINNWF INQRKRHWKP SEDMQFMVMD GLHPQNAALY  180
MDGHYMGDGP YRLGP
Functional Description ? help Back to Top
Source Description
UniProtProbably binds to the DNA sequence 5'-TGAC-3'.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007018399.12e-83PREDICTED: homeobox protein knotted-1-like 2
SwissprotO041351e-77KNAP2_MALDO; Homeobox protein knotted-1-like 2
TrEMBLA0A061FMA14e-82A0A061FMA1_THECC; KNOTTED-like from
STRINGEOY156247e-83(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65662335
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.12e-69KNOTTED-like from Arabidopsis thaliana