PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_5178_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family LBD
Protein Properties Length: 163aa    MW: 18056.2 Da    PI: 7.0027
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_5178_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.13.6e-4410108199
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrrkC +dC++apyfp e+p+kfanvhk+FGasnv+kll+++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l+ el++
  Neem_5178_f_1  10 PCAACKFLRRKCMPDCIFAPYFPPEEPQKFANVHKIFGASNVSKLLHEVLPHQREDAVNSLAYEAEARMKDPVYGCVGAISVLQRQVIKLQRELDA 105
                    7*********************************************************************************************99 PP

         DUF260  97 lke 99 
                    +++
  Neem_5178_f_1 106 TNA 108
                    876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.4279110IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-4310107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MASSSYSNSP CAACKFLRRK CMPDCIFAPY FPPEEPQKFA NVHKIFGASN VSKLLHEVLP  60
HQREDAVNSL AYEAEARMKD PVYGCVGAIS VLQRQVIKLQ RELDATNADL IRYACNEMPA  120
ATSSQFGRRN SGHGEGAFEQ NSGFYFPSHW TNNDGREGGE GSM
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002300051.12e-97LOB domain protein 25
SwissprotQ8L8Q35e-72LBD25_ARATH; LOB domain-containing protein 25
TrEMBLB9GI562e-97B9GI56_POPTR; LOB domain protein 25
STRINGPOPTR_0001s35280.17e-97(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.13e-73LOB domain-containing protein 25