PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_5003_f_6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HB-other
Protein Properties Length: 2199aa    MW: 246022 Da    PI: 8.4143
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_5003_f_6genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox391.4e-12755856
                   -HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox  8 tkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                   t+ q+e L +++ +++yp+++e+e+LA+ l+Lt +qV++WF  +R +ek
  Neem_5003_f_6  7 TPLQVEGLRRFYSEEKYPTKSEMEDLAAALDLTFKQVRTWFIEKRRREK 55
                   899********************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007113.75157IPR001356Homeobox domain
SMARTSM003891.4E-11161IPR001356Homeobox domain
CDDcd000864.38E-12555No hitNo description
Gene3DG3DSA:1.10.10.603.9E-12559IPR009057Homeodomain-like
SuperFamilySSF466895.13E-12560IPR009057Homeodomain-like
PfamPF000466.0E-10655IPR001356Homeobox domain
SMARTSM005711.1E-8386445IPR018501DDT domain
PROSITE profilePS5082712.273386445IPR018501DDT domain
PfamPF027914.8E-9389442IPR018501DDT domain
PfamPF156124.8E-7672707IPR028942WHIM1 domain
PfamPF156136.2E-11799872IPR028941WHIM2 domain
SuperFamilySSF527437.3E-2917651941IPR000209Peptidase S8/S53 domain
Gene3DG3DSA:3.40.50.2002.4E-2418021939IPR000209Peptidase S8/S53 domain
PfamPF000829.7E-1518072065IPR000209Peptidase S8/S53 domain
Gene3DG3DSA:3.40.50.2002.4E-2420512136IPR000209Peptidase S8/S53 domain
SuperFamilySSF527437.3E-2920532124IPR000209Peptidase S8/S53 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006508Biological Processproteolysis
GO:0003677Molecular FunctionDNA binding
GO:0004252Molecular Functionserine-type endopeptidase activity
Sequence ? help Back to Top
Protein Sequence    Length: 2199 aa     Download sequence    Send to blast
MEVKRKTPLQ VEGLRRFYSE EKYPTKSEME DLAAALDLTF KQVRTWFIEK RRREKTDNGV  60
VLPSPSSNKL TDTHGRNLGI ITGTKMVKGR DSSIHDRDKN TFSCSLKYKH VSSMVGNEHG  120
NKKNAVLLLQ DLLTPDYILK KVFRKDGPPL GVEFDSLPSQ AFCCYKGSGN FHPALQESQR  180
ANKRRKVPKH DELDCQDFCT NRDPVKKHGM GKGLMTAWRV MNPNGGIYPT GIDTAHRRDN  240
VVPQLSTGRS QKPPLRKKRA RQLVSLLKQR RLANKQRNKK KPLIRGRQVK LDKAESLMKP  300
QREKCELALE GEISEERLNQ IAMLVDDEEL ELRELEAGPN LLTCCDHIST KGPHGCSLCR  360
DLLAKFPPNS VKMKQPFGTQ PWDSSPEVVK KLFKVFHFLY TYAATVDICS FTLDEFAQAF  420
HDKDSLLLGK IHVALLKLLL SDVETELSRG RFAHLSVSCK FLALLHSVSV ENQEFFVEFW  480
NKSLNPLTWT EILRQVLVAA GFGSKQGSLR KESLSKEMNL MVKYGLRPGT LKGELFRILL  540
EQGNDGLKVF QLARSSQIAE LNLASTTEEV ELLISSTLSS DITLFEKISP SAYRLRFNSL  600
KETSDYESDT EYSGSVDDNS NDRDTCNSGD DSECDSQIRS QRRLKLVNFH KSKNNMLTVY  660
NEIDESHRGE MWLLGLMEGE YSDLTIDEKL NALVALIDLV SAGSSIRIED PIKTIAESIP  720
SVHHYGSGAK IKRALPNQHR LPRPSWVHEF HGVKEARASQ ELRPVDSSSL LSKSCGREKS  780
SSSDKHANTE VSSDLHPMQS VYLGSDRRFN RYWLFLGPCN AYDPGHKRVY FESSEDGQWE  840
VIDTEEALRA LLSVLDDRGR REALLIESLE KREAFLCHAM SSRLVNNAES WHLTQSDQSE  900
LDMVREDSSS PVSDVDNNLA LIEVAKDSLR SCGAIVLEVG KKGEEQNRKW NRLQEFDVWI  960
WNHFYLNLNA VKHGRRSYLD ALTRCESCHD LYWRDEKHCK RCHTTFELDF NLEERYAIHA  1020
ATCRGKGDHI GSKHKILSSQ LQSLKAAVHA IEVHYHMAVC FDVDTTFHIS EMKHTVLPTS  1080
VMPEDALVGV WTKSAHRLWA KRLRRTSSLA ELLQVVADFV SAINEDWLYQ WNVQIANIVM  1140
EEIIACFPAM PQTSSALALW LVKLDALIAP YLEQVNELLS NRSSSGLVLQ QDAALKLHNS  1200
SIAASFALLS FPDILLALVV AAIFHSGATD DDKQGEYSPS PQQISILQDV VKGRSATDSR  1260
VRRYTRSFSG FAAWLSSEEL LATKYPDSRV YELAKGNARG GVPSARIAVC ITSNKYCLTV  1320
ISFQPSVMLL LMALTSFPSS DAALIGAFHA VEKDLFTMQS PGNGGPFALS TRGIAPWILS  1380
LGAGSFDRRS IDQIILGNGK ILTASFCSIF YITNPRATIL KSEAVKETAA PVAVSFSVCG  1440
PNGIAPEILK VRHNLKHLYF RKPVVKAVDP GLVYEVAKAD YIAMHRSVNI TKSGKCPEPI  1500
KSSAKDLNYP TMAVQVESNK AFKLDFPRRV RNVGVSNTTY EAEITSTSQV NATVEPSIVS  1560
FISWKQYQQI LWPLLHCFGG TRNVRSPLVV IHVHFSTSQQ NAPDHCLLTC HYVLRRPSRM  1620
QLITQELEAN TVSFNFLSDR QEVASVITTH IRWKMKQHLD ELTIVSPSHN NYLNYRSLLL  1680
DFVPSISASF SFLYFSSILS VIVAVIGILS AGDEQVYIVY MGPLPKYEYS ALPHHISILE  1740
QVVNGRICCV ETVTNACSHE ALSVFPSGTY HLQTTRSWDF MGFAENVKRN PTVESDVIVG  1800
VVDGGIWPKD YTGHGTHTGS TAAGNKVSDV TFYGLVKGNT RGGVPSARIA VYSVCDSFMC  1860
TATEILAAFD DAIAEVVDII TCSLGPIIVN KLEDDTVTIG AFHAVEKGIL TVQSAGNSGP  1920
VARKMTRNAI NAFKTNETKF AITYGKQSSN CVDGNVRICS RDCVEKKSSK DKIVLCDFDR  1980
FTYPFGETIS VGAKGTTLLG FCDNNNESSV VPLPASTLRN IRDHNTLISY LNSKKNPQGT  2040
ILRSEVPKNR DAPVVASFSS RGPNLFPPEI LKVWQHLLSF QLTILHLEWN LNSTSVSWQM  2100
NATKHRDRKF AYGAGHVNPV KAVNPGLVYE VTKEDHMALL SSMNNTYFSK CPNHTAKVLQ  2160
KISITLQWQF KLKKTSHSKL ISQGRLEMLV CPTLPTNQK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3vta_A3e-56128821401491Cucumisin
3vta_B3e-56128821401491Cucumisin
4yn3_A3e-56128821401491Cucumisin
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator required for the maintenance of the plant vegetative phase. May prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing. {ECO:0000250|UniProtKB:F4HY56}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0044694e-49AP004469.1 Lotus japonicus genomic DNA, chromosome 4, clone: LjT15D01, TM0004a, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006447893.20.0homeobox-DDT domain protein RLT3 isoform X1
RefseqXP_006469383.10.0homeobox-DDT domain protein RLT3
RefseqXP_006469384.10.0homeobox-DDT domain protein RLT3
RefseqXP_024046871.10.0homeobox-DDT domain protein RLT3 isoform X1
SwissprotF4JRF50.0RLT3_ARATH; Homeobox-DDT domain protein RLT3
TrEMBLA0A067EIJ00.0A0A067EIJ0_CITSI; Uncharacterized protein
STRINGXP_006469383.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM96382125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12750.10.0Homeodomain-like transcriptional regulator