PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_4961_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family G2-like
Protein Properties Length: 158aa    MW: 16822.7 Da    PI: 11.0639
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_4961_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like41.92.3e-135352555
        G2-like 25 ekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    +A+Pk+i+elm+v+gL +++v+SHLQk+R+
  Neem_4961_f_1  5 SEAVPKRIVELMNVPGLKRDNVASHLQKFRI 35
                   57****************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.1E-12539IPR009057Homeodomain-like
SuperFamilySSF466894.84E-6639IPR009057Homeodomain-like
TIGRFAMsTIGR015579.1E-11635IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MALISEAVPK RIVELMNVPG LKRDNVASHL QKFRICLKRL NGVQGGISNA FCAPVETNMK  60
LGSLRRFDIQ ASAASGQIPP QILAALQAKL LGRPAGNLIT AIGQPALIQP SLQGPKCIPA  120
ENGIAFSRPL VKYQSNVSKH LPQSITSVGH ASTGFGHW
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006448148.13e-75two-component response regulator ORR21 isoform X2
SwissprotA2XE318e-36ORR21_ORYSI; Two-component response regulator ORR21
SwissprotQ8H7S78e-36ORR21_ORYSJ; Two-component response regulator ORR21
TrEMBLA0A067F0746e-74A0A067F074_CITSI; Two-component response regulator
TrEMBLV4U6207e-74V4U620_9ROSI; Two-component response regulator
STRINGXP_006448147.11e-74(Citrus clementina)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.13e-27response regulator 1
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]