PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_4533_f_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 127aa    MW: 14145.5 Da    PI: 8.6448
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_4533_f_3genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.25.9e-301059251
                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   rienk+ rqvtfskRr+g+lKKA+E+SvLCda+va+i+fs++gkl+eys+
  Neem_4533_f_3 10 RIENKISRQVTFSKRRAGLLKKAHEISVLCDADVALIVFSTKGKLFEYST 59
                   8***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.637161IPR002100Transcription factor, MADS-box
SMARTSM004326.0E-39160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.29E-28263IPR002100Transcription factor, MADS-box
CDDcd002653.42E-39261No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-30323IPR002100Transcription factor, MADS-box
PfamPF003198.1E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-303859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MGRGRVQLRR IENKISRQVT FSKRRAGLLK KAHEISVLCD ADVALIVFST KGKLFEYSTD  60
SRSVPVLYFE LETLFNQQSL LCMLLGAWFL TKDPGALCCW GLLYFTLLGE EDNLPNVSSA  120
SGGLQPG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A7e-20170171MEF2C
5f28_B7e-20170171MEF2C
5f28_C7e-20170171MEF2C
5f28_D7e-20170171MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006430951.12e-35truncated transcription factor CAULIFLOWER A
RefseqXP_006482432.12e-35truncated transcription factor CAULIFLOWER A
RefseqXP_008230294.15e-35PREDICTED: truncated transcription factor CAULIFLOWER A
SwissprotD7SMN63e-35FULL_VITVI; Agamous-like MADS-box protein FUL-L
TrEMBLA0A2H5P1P75e-34A0A2H5P1P7_CITUN; Uncharacterized protein
TrEMBLV4T3U95e-34V4T3U9_9ROSI; Uncharacterized protein
STRINGXP_006482431.18e-35(Citrus sinensis)
STRINGPOPTR_0012s05950.15e-35(Populus trichocarpa)
STRINGPOPTR_0017s13400.17e-35(Populus trichocarpa)
STRINGXP_006430951.18e-35(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.12e-35MIKC_MADS family protein
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]