PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_435_f_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family WRKY
Protein Properties Length: 506aa    MW: 55909.3 Da    PI: 8.3125
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_435_f_4genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.81.9e-32219277160
                   ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
          WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                   +dDgynWrKYGqK++kgse+prsYY+Ct+ +C vkkkvers+ d++v +i+Y++eHnhek
  Neem_435_f_4 219 VDDGYNWRKYGQKPIKGSEYPRSYYKCTHLNCLVKKKVERSS-DGQVAQIIYKNEHNHEK 277
                   59****************************************.***************85 PP

2WRKY104.55.6e-33392450159
                   ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
          WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                   ldDgy+WrKYGqK+vkg+++prsYY+Ct +gC+v+k+ver+ +d k+v++tYeg+Hnh+
  Neem_435_f_4 392 LDDGYRWRKYGQKVVKGNPHPRSYYKCTNPGCNVRKHVERAPTDSKAVITTYEGKHNHD 450
                   59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.7E-28213279IPR003657WRKY domain
PROSITE profilePS5081124.673214278IPR003657WRKY domain
SuperFamilySSF1182905.36E-26217278IPR003657WRKY domain
SMARTSM007744.6E-37219277IPR003657WRKY domain
PfamPF031061.2E-24220276IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.2E-36377452IPR003657WRKY domain
SuperFamilySSF1182903.14E-29384452IPR003657WRKY domain
PROSITE profilePS5081137.964387452IPR003657WRKY domain
SMARTSM007744.1E-39392451IPR003657WRKY domain
PfamPF031068.9E-26393450IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 506 aa     Download sequence    Send to blast
MAPGKEAEDS AKKMRPTIIL PPRPSTDSLY GSGFSPGPMT LVSSFFAEEL NNQSFSQLLA  60
GAMASPLARQ TQSFLVDNSK ESGNTDGDEK SSGFKESRPR NLVVARSPLF TVPPGLSPSG  120
LLNSPGFFSP QSPFGMSHQQ ALATVTAQAL FAQSNMQMQA EYQPSLLPPP AESVTVDEAF  180
QQQMQPSQSD PQSSAMESSQ ISHSDGKHMH PSVAVDKPVD DGYNWRKYGQ KPIKGSEYPR  240
SYYKCTHLNC LVKKKVERSS DGQVAQIIYK NEHNHEKPQL GRRAKDGSDA NENTNSQTKP  300
ELFMHSQIAQ VHSVPESNKE SSQAAPIQLP ESSDSEEVGD ADNRKEGDDE PNPKRRQVQN  360
LNVAGEVEVT VSHKTVTEPK IIVQTRSEVD LLDDGYRWRK YGQKVVKGNP HPRSYYKCTN  420
PGCNVRKHVE RAPTDSKAVI TTYEGKHNHD VPASKNSSHS TANNTASQLK PNKVVTRKHP  480
LLKEMDFGNN NQRPVLLRLK EEQIIV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-40219453878Probable WRKY transcription factor 4
2lex_A2e-40219453878Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Has a positive role in resistance to necrotrophic pathogens (e.g. Botrytis cinerea), but a negative effect on plant resistance to biotrophic pathogens (e.g. Pseudomonas syringae). {ECO:0000269|PubMed:18570649, ECO:0000269|PubMed:22219184}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By biotic and abiotic stresses such as pathogen infection (e.g. Botrytis cinerea and Pseudomonas syringae), salicylic acid (SA), jasmonic acid (JA), ethylene (ACC), liquid infiltration or spraying, and strongly during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756, ECO:0000269|PubMed:18570649}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4343504e-42AM434350.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X178339.3, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006482724.10.0probable WRKY transcription factor 4 isoform X1
SwissprotQ9XI901e-142WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLA0A067FZC20.0A0A067FZC2_CITSI; Uncharacterized protein
TrEMBLA0A2H5PKB40.0A0A2H5PKB4_CITUN; Uncharacterized protein
STRINGXP_006482724.10.0(Citrus sinensis)
STRINGXP_006431265.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15342792
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-131WRKY DNA-binding protein 4
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]