PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_42635_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family G2-like
Protein Properties Length: 339aa    MW: 38627.1 Da    PI: 6.6353
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_42635_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.42.8e-32164218155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k+r+rWt++LHe+Fve+v++LGG++kAtPk+il+lm+ +gLt+ hvkSHLQkYR+
  Neem_42635_f_1 164 KTRIRWTQDLHEKFVECVNRLGGADKATPKAILKLMDSDGLTIFHVKSHLQKYRM 218
                     68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.635161221IPR017930Myb domain
SuperFamilySSF466892.33E-17162218IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-28163219IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-23164219IPR006447Myb domain, plants
PfamPF002491.2E-8168217IPR001005SANT/Myb domain
PfamPF143791.2E-20249295IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MEEEQQRTLD PVRSSGTILG RFGSPASAFY ATERFMGFPQ YECEAGNPSV SSDFSRVSDS  60
QQFHSYQSPG ENYSIVSADQ AESLEIPWKF CKSPETSFRN SPLLGRPFSA PFDENQDHRV  120
CNNESYGLTS VSQLNYTYQK EKHSPRFSLS SGNSVSNGAV ITSKTRIRWT QDLHEKFVEC  180
VNRLGGADKA TPKAILKLMD SDGLTIFHVK SHLQKYRMAK YIPEYAGGNS EKRTSLNDLP  240
QLDVRATLQI KEALQLQLDV QRRLHEQLEI QRNLQMRIEE QGKQLKMLFD QQQKTNKNPW  300
KNQNLDIVVP EEDPRFSLED VEVSIAENSG NTRFPSKIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-22164221259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-22164221259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-22164221158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-22164221158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-22164221158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-22164221158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-22164221259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-22164221259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-22164221259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-22164221259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-22164221259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-22164221259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015380887.11e-154myb family transcription factor PHL5
TrEMBLA0A2H5MXR01e-153A0A2H5MXR0_CITUN; Uncharacterized protein
STRINGXP_006429845.11e-153(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54762748
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.12e-81G2-like family protein