PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_42098_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family bZIP
Protein Properties Length: 237aa    MW: 26210.6 Da    PI: 9.4568
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_42098_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.57.7e-101560550
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50
                    kr++r   NR +A rs +RK  ++ eLe+kv++L++e ++L  +l 
  Neem_42098_f_1 15 KRAKRILANRQSAARSKERKARYMLELERKVQTLQTEATTLSAQLT 60
                    9****************************************98775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.4E-161175IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.5651376IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.48E-101566No hitNo description
PfamPF001702.5E-81560IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.5E-101569No hitNo description
CDDcd147033.98E-211665No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MPPDKLAELW MVDPKRAKRI LANRQSAARS KERKARYMLE LERKVQTLQT EATTLSAQLT  60
LFQRDTTGLS AENTELKLRL QAMEQQAQLR DALNEALKKE VERLKIATGE IVNPSESFNM  120
GIHPMPYNHS NVFAVLQQSF NMGIHPMPYN HSNVFAVLQQ PAGAPTGHQN MQLSALSHSQ  180
SSTAAHHLQQ TSSQPASDVS KNDEVGRLQG LDISSKVSSF VKSEGPSLSA SESSTTF
Functional Description ? help Back to Top
Source Description
UniProtTranscrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269|PubMed:27896439}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010108472.11e-113transcription factor RF2b
SwissprotO228732e-71BZP18_ARATH; bZIP transcription factor 18
TrEMBLW9SAC21e-111W9SAC2_9ROSA; Transcription factor RF2b
STRINGXP_010108472.11e-112(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06850.18e-72basic leucine-zipper 52
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Pawar V, et al.
    A novel family of plant nuclear envelope-associated proteins.
    J. Exp. Bot., 2016. 67(19): p. 5699-5710
    [PMID:27630107]
  3. Gibalová A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  5. Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S
    Efficient gene tagging in Arabidopsis thaliana using a gene trap approach.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7
    [PMID:9356517]