PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_40298_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family WRKY
Protein Properties Length: 104aa    MW: 11985.4 Da    PI: 8.6939
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_40298_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1101.1e-342280159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY  1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                    l+Dg++WrKYGqK+vkg+++prsYYrCt  +C+v+k+ver+++dp+++++tYeg+Hnhe
  Neem_40298_f_1 22 LNDGFRWRKYGQKVVKGNPYPRSYYRCTNLKCKVRKHVERASDDPTAFITTYEGKHNHE 80
                    58********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.8E-37782IPR003657WRKY domain
SuperFamilySSF1182903.53E-301682IPR003657WRKY domain
PROSITE profilePS5081134.4291782IPR003657WRKY domain
SMARTSM007741.1E-392281IPR003657WRKY domain
PfamPF031069.9E-282380IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 104 aa     Download sequence    Send to blast
MSEEAMQEPR VVVQSSTDSE ILNDGFRWRK YGQKVVKGNP YPRSYYRCTN LKCKVRKHVE  60
RASDDPTAFI TTYEGKHNHE MPLRNTNPLT SEHDSLAPTS SDKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-351382877Probable WRKY transcription factor 4
2lex_A1e-351382877Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Functions with WRKY25 and WRKY33 as positive regulator of plant thermotolerance by partially participating in ethylene-response signal transduction pathway (PubMed:21336597). {ECO:0000250|UniProtKB:Q9SI37, ECO:0000269|PubMed:21336597}.
UniProtTranscription factor that binds specifically to the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Has a positive role in resistance to necrotrophic pathogens (e.g. Botrytis cinerea), but a negative effect on plant resistance to biotrophic pathogens (e.g. Pseudomonas syringae). {ECO:0000269|PubMed:18570649, ECO:0000269|PubMed:22219184}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By biotic and abiotic stresses such as pathogen infection (e.g. Botrytis cinerea and Pseudomonas syringae), salicylic acid (SA), jasmonic acid (JA), ethylene (ACC), liquid infiltration or spraying, and strongly during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756, ECO:0000269|PubMed:18570649}.
UniProtINDUCTION: By salicylic acid (PubMed:11449049). Induced by heat stress (PubMed:21336597). {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:21336597}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006428919.12e-58WRKY transcription factor 44 isoform X1
RefseqXP_006480560.12e-58WRKY transcription factor 44 isoform X1
RefseqXP_006480562.12e-58WRKY transcription factor 44 isoform X2
RefseqXP_024038132.12e-58WRKY transcription factor 44 isoform X1
RefseqXP_024038133.12e-58WRKY transcription factor 44 isoform X1
RefseqXP_024038134.12e-58WRKY transcription factor 44 isoform X2
RefseqXP_024955698.12e-58WRKY transcription factor 44 isoform X1
RefseqXP_024955699.12e-58WRKY transcription factor 44 isoform X1
RefseqXP_024955700.12e-58WRKY transcription factor 44 isoform X1
SwissprotQ9C5T32e-36WRK26_ARATH; Probable WRKY transcription factor 26
SwissprotQ9XI903e-36WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLA0A411PZL35e-57A0A411PZL3_9ROSI; WRKY family transcription factor
TrEMBLA0A411PZL44e-57A0A411PZL4_9ROSI; WRKY family transcription factor
TrEMBLV4URL84e-57V4URL8_9ROSI; Uncharacterized protein
STRINGXP_006480560.17e-58(Citrus sinensis)
STRINGXP_006428919.17e-58(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83622740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07100.21e-39WRKY DNA-binding protein 26
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]