PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_39787_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family LBD
Protein Properties Length: 119aa    MW: 13537.7 Da    PI: 10.3437
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_39787_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260121.64.3e-3812106195
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCa+Ck++rrkC+k+C la+yfpa+qpk+f+n+h+lFG+s + k+l++++++++++am+s+++e+++ra+ Pv+G++g+i++l++ql+ +  el 
  Neem_39787_f_1  12 ACAVCKYQRRKCQKNCRLARYFPADQPKTFQNAHRLFGVSGIAKILNNVDDDKKDRAMASIIFESNIRAKYPVNGCLGLIFSLEKQLQAAVDELR 106
                     7**************************************************************************************99988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.55511112IPR004883Lateral organ boundaries, LOB
PfamPF031956.7E-3612106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 119 aa     Download sequence    Send to blast
MTIKGEGGTK QACAVCKYQR RKCQKNCRLA RYFPADQPKT FQNAHRLFGV SGIAKILNNV  60
DDDKKDRAMA SIIFESNIRA KYPVNGCLGL IFSLEKQLQA AVDELRHEVS RKRMFGTHF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006482664.11e-53PREDICTED: LOB domain-containing protein 3-like
SwissprotQ9STS64e-36LBD27_ARATH; LOB domain-containing protein 27
TrEMBLV4SU836e-53V4SU83_9R
STRINGVIT_14s0066g02460.t012e-41(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.12e-37LOB domain-containing protein 27