PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_3828_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family LBD
Protein Properties Length: 196aa    MW: 21603.7 Da    PI: 9.2548
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_3828_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.61.6e-41461451100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++pe++r da++slv+eA+ r+rdPvyG++g i++lqqq+++l+ael++
  Neem_3828_f_1  46 PCAACKLLRRRCAEECPFSPYFSPHEPHKFAAVHKVFGASNVSKMLMEVPESHRADAANSLVFEANLRLRDPVYGCMGAISALQQQIQSLQAELNA 141
                    7*********************************************************************************************** PP

         DUF260  97 lkee 100
                    +k+e
  Neem_3828_f_1 142 VKSE 145
                    9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.50145146IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-4146143IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MFRDRERFDD EIEKRIKGES DVSNSQMGRR HMLGPSVGST LNTITPCAAC KLLRRRCAEE  60
CPFSPYFSPH EPHKFAAVHK VFGASNVSKM LMEVPESHRA DAANSLVFEA NLRLRDPVYG  120
CMGAISALQQ QIQSLQAELN AVKSEILRYK YREATANTII SSSSNGLISS AVVSLAASSS  180
SPSLSIPPPK INKKQY
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00283DAPTransfer from AT2G30340Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002520837.18e-95PREDICTED: LOB domain-containing protein 15
SwissprotQ9AT613e-79LBD13_ARATH; LOB domain-containing protein 13
TrEMBLB9S4B89e-95B9S4B8_RICCO; LOB domain-containing protein, putative
STRINGVIT_06s0004g07790.t019e-93(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.16e-74LOB domain-containing protein 15