PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_3807_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HB-other
Protein Properties Length: 1111aa    MW: 123092 Da    PI: 8.4605
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_3807_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.81.6e-07100156157
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
       Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                    +r+R  ++++ l+ ++e+F  +  +s++e +e++++ g+t +qVk +F  +R + +k
  Neem_3807_f_2 100 KRPRDLLNPKALKYMQEVFSVKDAISKRESREISAQFGVTVTQVKDFFASQRSRVRK 156
                    799**************************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.38297157IPR001356Homeobox domain
SMARTSM003892.1E-499161IPR001356Homeobox domain
PfamPF000465.7E-5100156IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.1E-7100165IPR009057Homeodomain-like
CDDcd000863.61E-5100156No hitNo description
SuperFamilySSF466895.99E-7100160IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1111 aa     Download sequence    Send to blast
MSGLYRSRTS SFELDNGGVE EEFFGDGDWE FGGIVSEVSG FAERAFPQPD RAAPKRCCHT  60
MQTNWSQSSF ARNALGFLLM CSDGFPFNKA AGALSIKIGK RPRDLLNPKA LKYMQEVFSV  120
KDAISKRESR EISAQFGVTV TQVKDFFASQ RSRVRKLVRL SREKAIKSNA CKEPQSDVVR  180
IISDSMIPID PVPLSSAGPT SVIPIDHLPL NSIGSLNVEE EPSCSGQDDS LVGIDDLDKH  240
FVENIFSLMR REETFSGQVK LMEWILQIEN SSVLFWFLTK GGVMILATWM SQAADEEQTS  300
VLSVILDVYS HLPLHKAFPE QMSAILQSVK RLRFYRASDL TNRARILLSK WSKLFARSQA  360
LKKPNGTKSC TDSENELILK QRQVLVFFFC LYLQDFFKLF LIVALYTWCS IGEIMADESW  420
QSNNNVSEAS LASSYESSEN LRKLESPQPL KLLTASSDDS ARKNILGASS SLTDNRERRK  480
VQFVEQPGQK MPGRSPQAAR AAPVSQARPM SADDIQKAKL RAMHMQNKYG KMGSSSNGSN  540
EVKTEGLNKL TTTQASIVLP ESKALVRPQI EEHKKAEMVQ SKISCKLESP LDSKQKMDIK  600
VPPEKCNRVL IRWQTPPEVK LNAVWRVGAG DNSKEVEVQK NRTHREKETV YHTVQEIPSN  660
PKEPWDLEMD YDDTLTLEIP TEQPPDAADN GETHVATTYN VTVNSADVTV PVSSHIGNAS  720
TTEPDLELLA VLLKNPELVF ALTSGQAGNL SNEDTVKLLD MIKAGGAVLP GNINGIGGKV  780
EEKVEVSLPS PTPSSNPGTS GWRQEVRIPF SRQSPMAPEV ASAVSSVEKH PPTNLVRSGI  840
SAMNVAMPQQ PAIVSQQVPA SMCSSLHQTN TIIPERQEPS VVPSLHQSRP ISFPIIQAQA  900
SEIHLSMKNL PIVSTSSNIN ATGGPSIRIE NNRSNARAAP THNNAPERQY SLPTSMPMPT  960
PVRSQAQQHF TTDPAHVASS FASRQPMGNL GPASDSGRTI QRFASNPRFE VNQNNLNAPS  1020
FGGPVQQHQL LSGCRRERNG YASTDGFESW SPENSPTRST EYMSRRNFPE PRTNTGWSSA  1080
SVERSRQWNS SGYREVREHN KHGNMCRDRR R
Functional Description ? help Back to Top
Source Description
UniProtSeems to play a role in the regulation of flowering time in the autonomous flowering pathway by repressing FLOWERING LOCUS C expression. {ECO:0000269|PubMed:10363371}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024955203.10.0homeobox protein LUMINIDEPENDENS
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A067HH030.0A0A067HH03_CITSI; Uncharacterized protein
STRINGXP_006479899.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM108762428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.20.0HB-other family protein
Publications ? help Back to Top
  1. Chakrabortee S, et al.
    Luminidependens (LD) is an Arabidopsis protein with prion behavior.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(21): p. 6065-70
    [PMID:27114519]