PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_3796_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family WRKY
Protein Properties Length: 479aa    MW: 53098.4 Da    PI: 7.2638
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_3796_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.43e-33137194260
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                    +DgynWrKYGqK+vkgse+prsY++Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh+k
  Neem_3796_f_1 137 EDGYNWRKYGQKQVKGSENPRSYFKCTFPDCPMKKKVERSL-DGQITEIVYKGSHNHPK 194
                    7****************************************.***************85 PP

2WRKY105.23.6e-33304362159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+vkg+++prsYY+Ct+ gCpv+k+ver+++d ++v++tYeg+Hnh+
  Neem_3796_f_1 304 LDDGYRWRKYGQKVVKGNPNPRSYYKCTTIGCPVRKHVERASHDARAVITTYEGKHNHD 362
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.7E-28125195IPR003657WRKY domain
PROSITE profilePS5081123.009131195IPR003657WRKY domain
SuperFamilySSF1182906.41E-25131195IPR003657WRKY domain
SMARTSM007742.7E-36136194IPR003657WRKY domain
PfamPF031064.3E-25137193IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.0E-37289364IPR003657WRKY domain
SuperFamilySSF1182902.62E-29296364IPR003657WRKY domain
PROSITE profilePS5081138.48299364IPR003657WRKY domain
SMARTSM007741.2E-38304363IPR003657WRKY domain
PfamPF031061.2E-25305362IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0010120Biological Processcamalexin biosynthetic process
GO:0010200Biological Processresponse to chitin
GO:0010508Biological Processpositive regulation of autophagy
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MILASPTTDA VNWNNNQQQN NKGEENNFFD FSFQTSQTRA SATASSSSNF LQSSSNIVSV  60
EESVKRQQEP WNFNKPTKQS DFSTENAGVK SEFAPIQSFS LEMGGYQTNA QTSAAPQSDY  120
SQHNQSTMYS REQKRSEDGY NWRKYGQKQV KGSENPRSYF KCTFPDCPMK KKVERSLDGQ  180
ITEIVYKGSH NHPKPQSTRR SSSSQSTQHA TCANSDLSDQ SAGPISNPQT ESFSMQGDSS  240
TSFGEDDFDQ GSPTSNPGGD DNENEPDAKR WKGENDIDGV IGTGSRTVRE PRIVVQTTSD  300
IDILDDGYRW RKYGQKVVKG NPNPRSYYKC TTIGCPVRKH VERASHDARA VITTYEGKHN  360
HDVPAARGSS YALTRPSPNV NSSNLPAPIR PSVTAIANHS NLSSYSNSFN NTRFPTSSGS  420
QTQFTAPMLQ NSGSYGYSGF GKQSNSYMNQ TQQLDGFFPR AKEEPKEDSF LESFLNSNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-38137365878Probable WRKY transcription factor 4
2lex_A4e-38137365878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00299DAPTransfer from AT2G38470Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006429505.10.0hypothetical protein CICLE_v10011386mg
RefseqXP_006481125.10.0PREDICTED: probable WRKY transcription factor 33 isoform X1
SwissprotQ8S8P51e-132WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLV4SUS10.0V4SUS1_9R
STRINGPOPTR_0016s13600.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45832755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-128WRKY DNA-binding protein 33