PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_371_f_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 91aa    MW: 10143.7 Da    PI: 11.2657
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_371_f_4genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.93.1e-293483251
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  ri+n++ rqvtfskRrng+lKKA ELS+LCdaev +++fsstgklyeys+
  Neem_371_f_4 34 RIDNSTSRQVTFSKRRNGLLKKARELSILCDAEVGLMVFSSTGKLYEYSN 83
                  8***********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.6E-402584IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.5812585IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.98E-292588IPR002100Transcription factor, MADS-box
CDDcd002651.54E-382689No hitNo description
PROSITE patternPS0035002781IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-292747IPR002100Transcription factor, MADS-box
PfamPF003192.7E-263481IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-294762IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-296283IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
MGRSETPRKP VPSTRERVGG TLGDMGRGKI VIRRIDNSTS RQVTFSKRRN GLLKKARELS  60
ILCDAEVGLM VFSSTGKLYE YSNSRLDNLS P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A1e-202589165MEF2C
5f28_B1e-202589165MEF2C
5f28_C1e-202589165MEF2C
5f28_D1e-202589165MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtTranscriptional factor that targets the CArG motif 5'-C(A/T)TTAAAAAG-3' in the promoter of D14. Directly suppresses D14 expression to control the outgrowth of axillary buds. {ECO:0000269|PubMed:23463009}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007148344.15e-34hypothetical protein PHAVU_006G200400g
RefseqXP_024034710.19e-34MADS-box transcription factor 27 isoform X3
SwissprotQ6EP493e-32MAD27_ORYSJ; MADS-box transcription factor 27
SwissprotQ6Z6W23e-32MAD57_ORYSJ; MADS-box transcription factor 57
TrEMBLA0A1L5YEI18e-33A0A1L5YEI1_PRUPE; MADS-box protein 12
TrEMBLA0A438GU853e-33A0A438GU85_VITVI; MADS-box transcription factor ANR1
STRINGVIT_03s0097g00160.t012e-33(Vitis vinifera)
STRINGEOX986152e-33(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G14210.13e-33AGAMOUS-like 44
Publications ? help Back to Top
  1. Guo S, et al.
    The interaction between OsMADS57 and OsTB1 modulates rice tillering via DWARF14.
    Nat Commun, 2013. 4: p. 1566
    [PMID:23463009]
  2. Puig J, et al.
    Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice.
    Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70
    [PMID:23466806]
  3. Yu C, et al.
    The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice.
    PLoS ONE, 2014. 9(8): p. e105597
    [PMID:25140876]
  4. Wang H, et al.
    A Signaling Cascade from miR444 to RDR1 in Rice Antiviral RNA Silencing Pathway.
    Plant Physiol., 2016. 170(4): p. 2365-77
    [PMID:26858364]