PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_36202_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MIKC_MADS
Protein Properties Length: 173aa    MW: 20016.9 Da    PI: 10.648
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_36202_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.21.6e-26953145
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    krien++nrqvt+skRrng++KKA+EL vLCda+v++i+ s+tgk
  Neem_36202_f_2  9 KRIENSTNRQVTYSKRRNGLFKKAHELTVLCDAKVSIIMCSTTGK 53
                    79*****************************************97 PP

2K-box57.36.8e-20481291091
           K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeen 91 
                     ++++ ++++++l+kLk+ ++nL++e++h+lGe+L++L l+eL  L+q++++sl+ iR++K + + e  ++l++ e+ +++ +
  Neem_36202_f_2  48 CSTTGKEMREKLRKLKEVNRNLRKEIKHRLGESLNELRLEELPTLQQDIDNSLRVIRERKVRSVDEINRNLRNVEEINKDLQ 129
                     6677899*****************************************************9887777777777666665544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.02153IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.76E-26164IPR002100Transcription factor, MADS-box
SMARTSM004324.8E-31160IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-24323IPR002100Transcription factor, MADS-box
PfamPF003195.3E-221053IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004047.9E-243859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.33952140IPR002487Transcription factor, K-box
PfamPF014864.3E-1353130IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MARGKIQIKR IENSTNRQVT YSKRRNGLFK KAHELTVLCD AKVSIIMCST TGKEMREKLR  60
KLKEVNRNLR KEIKHRLGES LNELRLEELP TLQQDIDNSL RVIRERKVRS VDEINRNLRN  120
VEEINKDLQN GFNINAKGED PHFRLVDNGG HYDSVIGFQS GGPGIFALRL QPN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A4e-13183190MEF2C
5f28_B4e-13183190MEF2C
5f28_C4e-13183190MEF2C
5f28_D4e-13183190MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the genetic control of flower development. Acts in conjunction with GLOBOSA (glo).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006435093.21e-77floral homeotic protein DEFICIENS
SwissprotP237066e-66DEFA_ANTMA; Floral homeotic protein DEFICIENS
TrEMBLA0A2H5NSB84e-76A0A2H5NSB8_CITUN; Uncharacterized protein
TrEMBLV4SKQ64e-76V4SKQ6_9ROSI; Uncharacterized protein
STRINGXP_006435093.16e-77(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2283834
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.13e-53MIKC_MADS family protein
Publications ? help Back to Top
  1. Schwarz-Sommer Z, et al.
    Characterization of the Antirrhinum floral homeotic MADS-box gene deficiens: evidence for DNA binding and autoregulation of its persistent expression throughout flower development.
    EMBO J., 1992. 11(1): p. 251-63
    [PMID:1346760]
  2. Sommer H, et al.
    Deficiens, a homeotic gene involved in the control of flower morphogenesis in Antirrhinum majus: the protein shows homology to transcription factors.
    EMBO J., 1990. 9(3): p. 605-13
    [PMID:1968830]
  3. Gallois JL, et al.
    Functional characterization of the plant ubiquitin regulatory X (UBX) domain-containing protein AtPUX7 in Arabidopsis thaliana.
    Gene, 2013. 526(2): p. 299-308
    [PMID:23747397]
  4. Davies B,Egea-Cortines M,de Andrade Silva E,Saedler H,Sommer H
    Multiple interactions amongst floral homeotic MADS box proteins.
    EMBO J., 1996. 15(16): p. 4330-43
    [PMID:8861961]