PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_35944_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HB-other
Protein Properties Length: 181aa    MW: 20615.7 Da    PI: 5.5295
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_35944_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox15.62.7e-053064438
                    -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCT CS
        Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklg 38
                    + +++ eq+++Le+ Fe  +++  e++ +LA+ l+
  Neem_35944_f_1 30 KKRLNLEQVKALEKSFELGNKLEPERKMQLARALD 64
                    4568889*************************994 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-51764IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MSFSGVNDKF EDVHGDEELS DDGSQVGEKK KRLNLEQVKA LEKSFELGNK LEPERKMQLA  60
RALDSSNEVS HHHHHNLKKE NEGSWSNGSD NSSDMNLDIS RTSVITTPVS SHLSSKQLFP  120
TSIRPASMTQ LLQGSSRPEL QCLKIDHQMV QDESFCNMFN RIEEQQAAAG YWQWTEQQNF  180
H
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021297591.13e-81homeobox-leucine zipper protein ATHB-20-like
TrEMBLA0A3N7G4G78e-68A0A3N7G4G7_POPTR; Uncharacterized protein
STRINGEOY034145e-63(Theobroma cacao)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-22HD-ZIP family protein