PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_35757_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HB-other
Protein Properties Length: 142aa    MW: 16700.6 Da    PI: 5.1123
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_35757_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.85.2e-10841182155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yp+++++  LA+++gL+++q+ +WF N+R ++
  Neem_35757_f_1  84 KWPYPTEADKITLAESTGLDQKQINNWFINQRKRH 118
                     679*****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007112.76258121IPR001356Homeobox domain
SuperFamilySSF466891.24E-2059133IPR009057Homeodomain-like
SMARTSM003891.4E-1360125IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.1E-2963122IPR009057Homeodomain-like
CDDcd000863.19E-1270122No hitNo description
PfamPF059205.1E-1878117IPR008422Homeobox KN domain
PROSITE patternPS00027096119IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
MRTEVGASSD EDYSGGEIDP QEPQPRDEDR DLKDRLLPGV LKEEEERKAL KTDYYLEFSK  60
KKKKGKLPKE ARQTLLDWWN LHYKWPYPTE ADKITLAEST GLDQKQINNW FINQRKRHWK  120
PSENMQFAVT DNLSGAPLFS DD
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007044712.15e-59PREDICTED: homeobox protein knotted-1-like 6
SwissprotQ84JS67e-48KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLA0A1R3IC417e-59A0A1R3IC41_9ROSI; Uncharacterized protein
STRINGEOY005442e-58(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8352785
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.13e-40KNOTTED1-like homeobox gene 6
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Khan M, et al.
    Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis.
    Plant Physiol., 2015. 169(3): p. 2166-86
    [PMID:26417006]