PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_35397_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 222aa    MW: 25424.3 Da    PI: 9.8661
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_35397_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF663.9e-211053245
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    + en+  rq t++kR++gi+KKA+ELS+LCd+++ +++fs+tgk
  Neem_35397_f_1 10 KLENTNGRQATYAKRKHGIMKKANELSILCDIDIILLMFSPTGK 53
                    6799**************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.563153IPR002100Transcription factor, MADS-box
SMARTSM004324.3E-28160IPR002100Transcription factor, MADS-box
CDDcd002664.05E-24282No hitNo description
SuperFamilySSF554555.36E-25295IPR002100Transcription factor, MADS-box
PRINTSPR004049.7E-17323IPR002100Transcription factor, MADS-box
PfamPF003191.5E-181154IPR002100Transcription factor, MADS-box
PRINTSPR004049.7E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004049.7E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MGRVKLKIKK LENTNGRQAT YAKRKHGIMK KANELSILCD IDIILLMFSP TGKPSLCNGK  60
RSSIEEVIAK FAQLTPQERA KRKLESLEAL KKTFKKLDHD VNVQEFLGTS SQTIEGFLIS  120
SRGTEIQSMQ CYWTNPDKIN SVEHLGQMEN SLREYLNQIR VHKENLGKQQ LMSLECSSQF  180
QHGMHIPFRL GSEQQLQPLS WIPSNDNRPL VLPEDPNLLS HR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A2e-13192190MEF2 CHIMERA
6byy_B2e-13192190MEF2 CHIMERA
6byy_C2e-13192190MEF2 CHIMERA
6byy_D2e-13192190MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms heterodimers with the MADS-box proteins AGL66 and AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006438714.11e-135agamous-like MADS-box protein AGL30 isoform X2
RefseqXP_024041454.11e-135agamous-like MADS-box protein AGL30 isoform X1
RefseqXP_024956614.11e-135agamous-like MADS-box protein AGL30 isoform X3
SwissprotQ1PFA41e-87AGL30_ARATH; Agamous-like MADS-box protein AGL30
TrEMBLA0A2H5N8Y11e-134A0A2H5N8Y1_CITUN; Uncharacterized protein
STRINGXP_006483134.11e-134(Citrus sinensis)
STRINGXP_006438714.11e-134(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59332543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.29e-79AGAMOUS-like 30
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]