PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_34780_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family LBD
Protein Properties Length: 172aa    MW: 19750.8 Da    PI: 7.0846
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_34780_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260130.66.5e-41141131100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C ++C lapyfp+++++kfa+vhk+FGasnv+k+++ ++e++r+da++++vyeA+ar+rdPvyG++g  ++l++ +e+lka+l+
  Neem_34780_f_1  14 PCAACKFLRRRCDSNCLLAPYFPQDEREKFACVHKVFGASNVIKMIQMVEETKRDDAVKAIVYEAKARLRDPVYGSAGATFHLHKMVEELKAQLE 108
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                     ++k++
  Neem_34780_f_1 109 SIKTQ 113
                     99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.92513114IPR004883Lateral organ boundaries, LOB
PfamPF031957.4E-4014111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MGSQMVLRAR THQPCAACKF LRRRCDSNCL LAPYFPQDER EKFACVHKVF GASNVIKMIQ  60
MVEETKRDDA VKAIVYEAKA RLRDPVYGSA GATFHLHKMV EELKAQLESI KTQVRDSQER  120
RNQLLGILMN VHHQDPVSPL NDAMFAYDDF FIDDGTLAYD PVKFPVECDW IL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007051513.14e-83LOB domain-containing protein 11
TrEMBLA0A061DSL04e-83A0A061DSL0_THECC; LOB domain-containing protein 11
STRINGVIT_15s0046g00230.t013e-81(Vitis vinifera)
STRINGPOPTR_0014s16510.13e-81(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1863068
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-46LOB domain-containing protein 1