PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_34357_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family WRKY
Protein Properties Length: 246aa    MW: 27862.3 Da    PI: 8.9026
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_34357_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.32.8e-32168226159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+
  Neem_34357_f_1 168 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAEDPRMVITTYEGRHVHS 226
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.6E-33153226IPR003657WRKY domain
SuperFamilySSF1182901.44E-28160227IPR003657WRKY domain
PROSITE profilePS5081129.356163228IPR003657WRKY domain
SMARTSM007749.8E-37168227IPR003657WRKY domain
PfamPF031063.9E-25169225IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901141Biological Processregulation of lignin biosynthetic process
GO:1904369Biological Processpositive regulation of sclerenchyma cell differentiation
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MSSTTQAMLN QSLFDQEQEM QTQMGFLPFP PSLSFPLLGS CNNQSLKSFT INSLPHPSSL  60
AAHENEVPSS TTINLTETLL LSSAGNIKQR EDHITSSADL GGPQLLSLQR SNANLWAWGE  120
ANESLSSKKM AGEDHLGVAA VKMKKIKSRR KVREPRFCFK TMSDIDVLDD GYKWRKYGQK  180
VVKNTQHPRS YYRCTQDNCR VKKRVERLAE DPRMVITTYE GRHVHSPSHD QEDSSQASSH  240
LNNFFW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-26160225974Probable WRKY transcription factor 4
2lex_A2e-26160225974Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006464513.11e-125probable WRKY transcription factor 13 isoform X1
SwissprotQ9SVB74e-64WRK13_ARATH; Probable WRKY transcription factor 13
TrEMBLA0A067DNU11e-125A0A067DNU1_CITSI; Uncharacterized protein
STRINGXP_006464513.11e-124(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61062746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.16e-67WRKY DNA-binding protein 13