PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_34206_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family G2-like
Protein Properties Length: 365aa    MW: 41154.2 Da    PI: 8.652
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_34206_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.4e-3297150255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     prlrWtp+LH +Fv+ave+LGG+e+AtPk +l+lm+vkgL+++hvkSHLQ+YR+
  Neem_34206_f_1  97 PRLRWTPDLHLAFVHAVEKLGGQERATPKLVLQLMNVKGLSIAHVKSHLQMYRS 150
                     8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-3093151IPR009057Homeodomain-like
PROSITE profilePS5129413.34993153IPR017930Myb domain
SuperFamilySSF466891.09E-1495151IPR009057Homeodomain-like
TIGRFAMsTIGR015578.2E-2397152IPR006447Myb domain, plants
PfamPF002492.9E-998149IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MESMTDTIEI SSDENKSNAS KIQAQNSSLA SSQKCSSFDL NLEAADDEND SPTNAPYKAY  60
VNDRSSPEGT SSTNTDATME GKERATMVRQ YVRSKMPRLR WTPDLHLAFV HAVEKLGGQE  120
RATPKLVLQL MNVKGLSIAH VKSHLQMYRS KKLDASGLVV SQNNRSMQGR HHILEMYQRF  180
DPHGNLRMDN RNYMSSPLLK QPHHPWASNG QYCSRFSPLR TCGDASLDEI QVKSAIFQNE  240
KKLSSSNLFE VKEAMAGNEP IRPSRFLEEK RWPPREMIGN QGRLRDNSLS ISWDDSCAVR  300
SSTCNGRITG IKDQFQPRTC SSMFTSNSYD SKFQTSPLLE AQRLQIGEAH CVKQENLSPD  360
LKLSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-1998152458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-1998152458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A6e-1998152357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-1998152357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-1998152357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-1998152357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-1998152458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-1998152458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-1998152458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-1998152458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-1998152458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-1998152458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024950476.11e-107uncharacterized protein LOC102628788
RefseqXP_024950477.11e-107uncharacterized protein LOC102628788
TrEMBLV4W2901e-104V4W290_9ROSI; Uncharacterized protein
STRINGXP_006469002.11e-106(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-39G2-like family protein