PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_33888_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HB-other
Protein Properties Length: 253aa    MW: 28694.2 Da    PI: 10.4525
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_33888_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.92e-09184232654
                     S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     +++k q+++Le ++++++ ps +++  + + ++L+ r++  WF  +Ra 
  Neem_33888_f_1 184 RLKKVQVKTLEMVYRRSKRPSNAMISSIVQVTNLPRRRIVKWFEDKRAE 232
                     57889******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.863176236IPR001356Homeobox domain
SuperFamilySSF466895.13E-10179245IPR009057Homeodomain-like
CDDcd000861.56E-7179231No hitNo description
SMARTSM003894.2E-6182240IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.9E-9184243IPR009057Homeodomain-like
PfamPF000466.0E-7184232IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002229Biological Processdefense response to oomycetes
GO:0009414Biological Processresponse to water deprivation
GO:0009682Biological Processinduced systemic resistance
GO:0009787Biological Processregulation of abscisic acid-activated signaling pathway
GO:0010118Biological Processstomatal movement
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000071Biological Processregulation of defense response by callose deposition
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MALALSMSIT SSSRAVHCLS PSHNERLFAG HLKTLNLVLP RHPLSPFALA FSRRRNNGPA  60
ITSSSSSSKK KKGFPLCKKL DAMPENSCLK RSCNNCEQKH KIKSIAAELC LDRSVVLEML  120
REPPPNLLML SAALPDEPAA KVLVHEVKHT ETIMAETTVH AVEPETKEEE PVHDRQHRWS  180
AQKRLKKVQV KTLEMVYRRS KRPSNAMISS IVQVTNLPRR RIVKWFEDKR AEEGVPEQRT  240
PYQWPDPETV SSR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15271RRRNNGPAITSSSSSSKKKK
Functional Description ? help Back to Top
Source Description
UniProtMay modulate chromatin structure by regulation of nucleosome assembly/disassembly (By similarity). Homeodomain transcription factor that mediates jasmonic acid (JA)-mediated COI1-dependent and abscisic acid (ABA)-mediated PMR4-dependent resistance to infection by necrotrophic fungal pathogens (e.g. B.cinerea and P.cucumerina) and bacterial pathogens (e.g. P.syringae DC3000); this resistance involves at least callose deposition (PubMed:15923348, PubMed:20836879, PubMed:21564353). Required for the P.fluorescens WCS417r-triggered JA-dependent induced systemic resistance (ISR) against both P.syringae DC3000 and H.arabidopsidis (PubMed:20836879). Negative regulator of the ABA-dependent drought resistance (PubMed:19175769). {ECO:0000250|UniProtKB:Q70Z19, ECO:0000269|PubMed:15923348, ECO:0000269|PubMed:19175769, ECO:0000269|PubMed:20836879, ECO:0000269|PubMed:21564353}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Constitutively expressed in healthy plants but repressed in response to infection by necrotrophic fungi (PubMed:15923348). Repressed by drought and abscisic acid (ABA) (PubMed:19175769). {ECO:0000269|PubMed:15923348, ECO:0000269|PubMed:19175769}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006450473.17e-84protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3 isoform X3
SwissprotQ8H0V51e-52OCP3_ARATH; Protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
TrEMBLV4TT402e-82V4TT40_9ROSI; Uncharacterized protein
STRINGXP_006450473.13e-83(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM120772631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.17e-55overexpressor of cationic peroxidase 3
Publications ? help Back to Top
  1. García-Andrade J,Ramírez V,López A,Vera P
    Mediated plastid RNA editing in plant immunity.
    PLoS Pathog., 2013. 9(10): p. e1003713
    [PMID:24204264]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Gamir J,Pastor V,Kaever A,Cerezo M,Flors V
    Targeting novel chemical and constitutive primed metabolites against Plectosphaerella cucumerina.
    Plant J., 2014. 78(2): p. 227-40
    [PMID:24506441]