PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_3377_f_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family WRKY
Protein Properties Length: 193aa    MW: 21775.8 Da    PI: 9.3544
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_3377_f_3genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.72e-32114172159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK vk+s +prsYYrCt+++C+vkk+v+r ++d+++v++tYeg Hnh+
  Neem_3377_f_3 114 LDDGYRWRKYGQKAVKNSIYPRSYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGVHNHP 172
                    59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.3E-33100172IPR003657WRKY domain
SuperFamilySSF1182901.7E-28107173IPR003657WRKY domain
PROSITE profilePS5081129.011109174IPR003657WRKY domain
SMARTSM007741.1E-37114173IPR003657WRKY domain
PfamPF031069.9E-26115172IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MDQGQEQPPL PSPTPPLLPP LNPPYVFTPS LPSSSLHPPL EPQILPDIDW VSLLSGQPGL  60
GENGPVLEST SVIADNGGEE DKGIKENNKR KGSRIKRATR PRFAFQTRSA DDILDDGYRW  120
RKYGQKAVKN SIYPRSYYRC THHTCNVKKQ VQRLSKDTSI VVTTYEGVHN HPCEKLMETL  180
TPLLKQMQFL ARF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-24104171774Probable WRKY transcription factor 4
2lex_A3e-24104171774Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00317DAPTransfer from AT2G46130Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022759566.11e-105probable WRKY transcription factor 43 isoform X1
SwissprotQ8GY112e-56WRK43_ARATH; Probable WRKY transcription factor 43
TrEMBLA0A1Q3B7K91e-96A0A1Q3B7K9_CEPFO; WRKY domain-containing protein
TrEMBLG3FF751e-96G3FF75_9ROSI; WRKY transcription factor 23-1 (Fragment)
STRINGXP_006491470.12e-95(Citrus sinensis)
STRINGXP_006444939.12e-95(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50928154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46130.11e-58WRKY DNA-binding protein 43
Publications ? help Back to Top
  1. Geilen K,Heilmann M,Hillmer S,Böhmer M
    WRKY43 regulates polyunsaturated fatty acid content and seed germination under unfavourable growth conditions.
    Sci Rep, 2017. 7(1): p. 14235
    [PMID:29079824]