PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_3326_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family G2-like
Protein Properties Length: 475aa    MW: 52332.3 Da    PI: 5.9826
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_3326_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like34.73.9e-11245270127
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekA 27 
                    k+r+rWt+eLHe F++av++LGG+e  
  Neem_3326_f_2 245 KQRIRWTTELHELFIDAVNKLGGPE-S 270
                    79*********************98.4 PP

2G2-like88.37e-28274324555
        G2-like   5 rWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     Wt+eLHe F++av++LGG+e AtPk il lm+v+gL ++hvkSHLQkYR 
  Neem_3326_f_2 274 TWTTELHELFIDAVNKLGGPESATPKGILMLMDVEGLNIYHVKSHLQKYRH 324
                    6*************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.69E-5243270IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-8244273IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-7245273IPR006447Myb domain, plants
PROSITE profilePS512949.964267327IPR017930Myb domain
SuperFamilySSF466896.87E-15272325IPR009057Homeodomain-like
PfamPF002491.5E-7273323IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.6E-21274324IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.7E-24274325IPR009057Homeodomain-like
PfamPF143791.6E-14360405IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MEASYNGTSP GHNLSADESS ANLNGVMEAS YDGTSPGHNL SADESSIGLF SLSKNSSLSA  60
LLSRSKTPNS LLEASLFQPW KFIANPMSSR DSGTNQQLIS PPLVPYRVAC DHQSTFPFHH  120
PNFNPPLLGG DATTTSDKDS PGNLMDSLSM PGESSAGCQG SEYVKGGLSL TERLQLHQLS  180
QELGIASNDV DSGNSTIDEI FEAPQCLAIP ISEVDSNRNN FSSIAGVHDY IHPSHRHTEP  240
AAVHKQRIRW TTELHELFID AVNKLGGPES EPKTWTTELH ELFIDAVNKL GGPESATPKG  300
ILMLMDVEGL NIYHVKSHLQ KYRHAKNFPE IKQDKRTLSS VGKKQLSASN DIDAPIKRKE  360
VVETLHLQIE VQRQLHEQLK AQKLLQLRIE QQGEYLRKLM EEREKGGSSL FSIHDLPSFI  420
NSRPESEVPL LSLHPDTSAE QVESNSDSSS SQSKNKASIA FECEQPKCQK RLRQD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A7e-20275326758Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B7e-20275326758Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A7e-20275326758Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C7e-20275326758Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D7e-20275326758Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F7e-20275326758Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H7e-20275326758Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J7e-20275326758Protein PHOSPHATE STARVATION RESPONSE 1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2122345
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.21e-44G2-like family protein