PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_3293_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family LBD
Protein Properties Length: 176aa    MW: 19519.2 Da    PI: 7.5624
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_3293_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260144.62.9e-4561051100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +Ca+Ck+lrr+CakdCv+apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +la+
  Neem_3293_f_1   6 PCASCKLLRRRCAKDCVFAPYFPSDDPHKFAIVHKVFGASNVSKMLQELPVHQRADAVSSLVYEANARVRDPVYGCVGAISFLQNQVSQLQMQLAV 101
                    7*********************************************************************************************** PP

         DUF260  97 lkee 100
                    +++e
  Neem_3293_f_1 102 AQAE 105
                    9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7955106IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-446103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MGANSPCASC KLLRRRCAKD CVFAPYFPSD DPHKFAIVHK VFGASNVSKM LQELPVHQRA  60
DAVSSLVYEA NARVRDPVYG CVGAISFLQN QVSQLQMQLA VAQAEILCIQ MQQEPTTMPT  120
TTPQIDPDDK SFLLQNNLSP HHHYLNFASS SSSSDSFVVH HDSLKRKTIF GHDMVS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006435806.11e-104hypothetical protein CICLE_v10032929mg
RefseqXP_006486261.11e-104PREDICTED: LOB domain-containing protein 12
SwissprotQ8LBW34e-77LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A067FN821e-104A0A067FN82_CITSI; Uncharacterized protein
TrEMBLV4TH271e-104V4TH27_9R
STRINGPOPTR_0008s07280.15e-98(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.14e-71LBD family protein