PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_32264_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family G2-like
Protein Properties Length: 404aa    MW: 45676.1 Da    PI: 9.6064
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_32264_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.38.2e-29212261251
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                     pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ
  Neem_32264_f_1 212 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQ 261
                     9************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-13209262IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-25210261IPR009057Homeodomain-like
TIGRFAMsTIGR015579.6E-21212262IPR006447Myb domain, plants
PfamPF002494.3E-6213262IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNSK PSSTWRRTEE EMDLGFWKRT LDSRNTISSM AKPDTGFELS  60
LSNPRVSESN STQFHLLQNS SNCNGNVFHS FQQNQYPAAL HHQHHQNQLH NHSPVLYHQQ  120
QQQQQGLSQE LGFLRPIRGI PVYQNPHPHH PASPSFPFPH HQQPLDSSLT ASSPSLVTNN  180
TSTSSLSSFQ SQGLMRSRFM SRFPAKRSMR APRMRWTTTL HARFVHAVEL LGGHERATPK  240
SVLELMDVKD LTLAHVKSHL QLVLRYKYYT PAVLMKLIMY RTVKTTDRAA ASSGQSDAFE  300
NGSSGDTSED MMFDIQQPRR PELSIQQGRP NAHQEKEYHG LWSNSSREAW LHGKSKDSAG  360
NLPSLEEMDP KFLSYEGISD VSSPNVTGTS PKKPNLEFTL GRPH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-13213261452Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-13213261452Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-13213268358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-13213268358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-13213268358Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-13213268358Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-13213261452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-13213261452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-13213261452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-13213261452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-13213261452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-13213261452Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates lateral organ polarity. Promotes abaxial cell fate during lateral organd formation. Functions with KAN1 in the specification of polarity of the ovule outer integument. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4839313e-59AM483931.2 Vitis vinifera contig VV78X206734.9, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021293487.10.0LOW QUALITY PROTEIN: probable transcription factor KAN2
SwissprotQ9C6162e-93KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A061G7400.0A0A061G740_THECC; Homeodomain-like superfamily protein isoform 1
STRINGEOY251940.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.16e-92G2-like family protein
Publications ? help Back to Top
  1. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]