PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_31989_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family YABBY
Protein Properties Length: 173aa    MW: 19316.3 Da    PI: 9.2225
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_31989_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY431.7e-1334732261
           YABBY 22 lavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaes 61
                    + vsvP +s+f++vtvrCGhC++llsv++  + q++++++
  Neem_31989_f_1 34 VYVSVPCSSMFNIVTVRCGHCANLLSVSMGSSLQTIPVQD 73
                    359*****************************99999987 PP

2YABBY122.56.5e-3894148116170
           YABBY 116 irPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                     +  PekrqrvPsaynrfikeeiqrikasnPdishreafs+aaknWahfP+ihfgl
  Neem_31989_f_1  94 NAAPEKRQRVPSAYNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHFPHIHFGL 148
                     668**************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046901.1E-133473IPR006780YABBY protein
PfamPF046902.9E-3692148IPR006780YABBY protein
SuperFamilySSF470955.24E-895141IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.103.1E-596142IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MKPDLGTKVV GFVDGVYCYK FKCTTIWVET YVSVYVSVPC SSMFNIVTVR CGHCANLLSV  60
SMGSSLQTIP VQDPQLCLLP LKLTYLGFST VINNAAPEKR QRVPSAYNRF IKEEIQRIKA  120
SNPDISHREA FSTAAKNWAH FPHIHFGLKV DGNKQAKLDQ TFAEGTQKSS GFY
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the abaxial cell fate determination during embryogenesis and organogenesis. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007015607.15e-72PREDICTED: putative axial regulator YABBY 2
SwissprotQ9XFB05e-51YAB2_ARATH; Putative axial regulator YABBY 2
TrEMBLA0A061GUT11e-70A0A061GUT1_THECC; Plant-specific transcription factor YABBY family protein isoform 1
STRINGEOY332262e-71(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55812749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08465.12e-49YABBY family protein
Publications ? help Back to Top
  1. Sacharowski SP, et al.
    SWP73 Subunits of Arabidopsis SWI/SNF Chromatin Remodeling Complexes Play Distinct Roles in Leaf and Flower Development.
    Plant Cell, 2015. 27(7): p. 1889-906
    [PMID:26106148]