PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_3175_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family TCP
Protein Properties Length: 375aa    MW: 42229.6 Da    PI: 9.7645
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_3175_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP132.73.4e-41942242137
            TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksaaks 97 
                    ++kkdrhski+T++g+RdRRvRls+ +  +fF+Lqd+LGf k+skt+ WLl++a  ai el++ +++ +  +     + ++++++ +++ +++ ++
  Neem_3175_f_1  94 PVKKDRHSKIYTARGLRDRRVRLSIGISQEFFALQDMLGFEKASKTLGWLLNKARNAINELAEMKNTGNIGS----AKREEGHENGDSEGTDSRNK 185
                    68**************************************************************77777333....33333333333444444444 PP

            TCP  98 kksqksaasalnlakesrakarararertrekmriknkln 137
                    +  ++++ +++ lake r karararertrekm++k +l+
  Neem_3175_f_1 186 QL-ESRKVAVQILAKEARDKARARARERTREKMCTKLNLQ 224
                    44.444444899***********************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036349.5E-3495219IPR005333Transcription factor, TCP
PROSITE profilePS5136930.79596154IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137011.215199216IPR017888CYC/TB1, R domain
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MFSSNSNIYS LPNRSSSYHQ FHPVFSGYEN NEVLLHHQHD LLTGLLLPAN PRITDSLTNM  60
AFTGNNNTVI KQDFNSKNAE SYGDASKFVP RKKPVKKDRH SKIYTARGLR DRRVRLSIGI  120
SQEFFALQDM LGFEKASKTL GWLLNKARNA INELAEMKNT GNIGSAKREE GHENGDSEGT  180
DSRNKQLESR KVAVQILAKE ARDKARARAR ERTREKMCTK LNLQKCKKVV DTCPQILTEF  240
RSSSQFKACE ASTSIAHNFA SSFNVVAEAK GQPCSQEPAN QAPMEGVPEQ VSNFNMLKTK  300
QNPSPIPAYQ QNLEISICNT SNNNCNLPQN WDMIDSAMPQ FSSFRTVTTN MNLSTGLQIY  360
GKTCWETRNS MCQRQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00215DAPTransfer from AT1G67260Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017974553.12e-75PREDICTED: transcription factor CYCLOIDEA
TrEMBLA0A061EIM98e-70A0A061EIM9_THECC; LST1, putative
STRINGEOY042621e-70(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67332744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67260.21e-29TCP family protein