PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_3139_f_11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family G2-like
Protein Properties Length: 489aa    MW: 55077.5 Da    PI: 6.8394
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_3139_f_11genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.16.2e-31252306155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k+rlrWt+eLH rF eav+qLGG+++AtPk il++m+++gLt++hvkSHLQkYR+
  Neem_3139_f_11 252 KERLRWTQELHYRFEEAVNQLGGPDRATPKGILKAMGIPGLTIYHVKSHLQKYRI 306
                     68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF121657.5E-39280IPR021998Alfin
SuperFamilySSF579037.09E-19120184IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.102.0E-18124181IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS500169.374129181IPR019787Zinc finger, PHD-finger
CDDcd156131.69E-32131181No hitNo description
SMARTSM002495.1E-10131179IPR001965Zinc finger, PHD-type
PfamPF006281.5E-10132180IPR019787Zinc finger, PHD-finger
PROSITE patternPS013590132178IPR019786Zinc finger, PHD-type, conserved site
PROSITE profilePS5129411.101249309IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-29250307IPR009057Homeodomain-like
SuperFamilySSF466892.69E-17251306IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-23252307IPR006447Myb domain, plants
PfamPF002492.9E-9254305IPR001005SANT/Myb domain
PfamPF143799.8E-14338381IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0042393Molecular Functionhistone binding
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MWEVTLPAEE VPPELPEPAL GINFARDGMN RKDWLSLVAV HTDSWLLSVA FYLGARLNRN  60
ERKRLFSLIN DLPTVFEVVT ERKPIKDKPS VDSSSKSRGS TKRSNDGQVK NNPKLADESY  120
EDEEDEHSET LCGSCGGNYN ADEFWIGCDI CERWFHGKCV KITPAKAENI KQYKCPSCSM  180
KRGRHQSISV IVLIAHIDIL LCFQPYFVLV ILVSIIPSTR EPSALAIAIA WVTHSLVPNT  240
DMGSNRSDGS GKERLRWTQE LHYRFEEAVN QLGGPDRATP KGILKAMGIP GLTIYHVKSH  300
LQKYRISKFI PESATRGKFE RRSISEMLPN FATTSAAQLN EALQMQTEVY RQMNDQLEVQ  360
RSLKLKIQAQ GRFLDRIAED HRNRATAINA KSGKPYSPMS LPSLCEESES NAKEFESDSE  420
ADRNEIESAE GVRGPKRLRV EDDILPSIFR LSSISPDAYN KDMQAYPAQD ISIPWNFSAC  480
PSPLVPSFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5xvl_A1e-3328552135PHD finger protein ALFIN-LIKE 2
5xvw_A1e-3328552135PHD finger protein ALFIN-LIKE 2
5xvw_B1e-3328552135PHD finger protein ALFIN-LIKE 2
5xvw_C1e-3328552135PHD finger protein ALFIN-LIKE 2
5xvw_E1e-3328552135PHD finger protein ALFIN-LIKE 2
5y21_A1e-3328552135PHD finger protein ALFIN-LIKE 2
5y21_B1e-3328552135PHD finger protein ALFIN-LIKE 2
5y53_A1e-3328552135PHD finger protein ALFIN-LIKE 2
5y53_B1e-3328552135PHD finger protein ALFIN-LIKE 2
5y53_C1e-3328552135PHD finger protein ALFIN-LIKE 2
5y53_E1e-3328552135PHD finger protein ALFIN-LIKE 2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006429402.21e-146myb family transcription factor PHL7
RefseqXP_006481047.11e-146myb family transcription factor PHL7-like
TrEMBLA0A4D8Y7K51e-156A0A4D8Y7K5_SALSN; Uncharacterized protein
STRINGXP_006429402.11e-148(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM168021011
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-50G2-like family protein