PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_3061_f_5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 402aa    MW: 45151 Da    PI: 6.1392
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_3061_f_5genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF64.79.6e-211053245
                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
         SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                   + en+  rq t++kR++gi+KKA+ELS+LCd+++ +++fs+tgk
  Neem_3061_f_5 10 KLENTNGRQATYAKRKHGIMKKANELSILCDIDIILLMFSPTGK 53
                   6799**************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.3E-28160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.563153IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-24295IPR002100Transcription factor, MADS-box
CDDcd002661.23E-24282No hitNo description
PRINTSPR004044.1E-16323IPR002100Transcription factor, MADS-box
PfamPF003193.8E-181154IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-162338IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-163859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MGRVKLKIKK LENTNGRQAT YAKRKHGIMK KANELSILCD IDIILLMFSP TGKPSLCNGK  60
RSSIEEVIAK FAQLTPQERA KRKLESLEAL KKTFKKLDHD VNVQEFLGTS SQTIEGFLIS  120
SRGTEIQSMQ CYWTNPDKIN SVEHLGQMEN SLREYLNQIR VHKENLGKQQ LMSLECSSQF  180
QHGMHIPFRL GSEQQLQPLS WIPSNDNRPL VLPEDPNLLS HRDVECSGSS SFGSYSGYFG  240
TGKSSEISNS GQESSLLSEL SGTASLRLQL GGQCSYLPYN VNLLNDKFQP VSDMNIQENP  300
VDYHVNGSLE VPRPGYDTTH GSWASTSGPC EVTLFDESVY SQASYFNSTE IQKRRYHPIT  360
DQVAEEVGHE WEIFSSITMD LLILQWSLAI PMSELASEIC IA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A7e-13192190MEF2 CHIMERA
6byy_B7e-13192190MEF2 CHIMERA
6byy_C7e-13192190MEF2 CHIMERA
6byy_D7e-13192190MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms heterodimers with the MADS-box proteins AGL66 and AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024956614.10.0agamous-like MADS-box protein AGL30 isoform X3
SwissprotQ1PFA41e-111AGL30_ARATH; Agamous-like MADS-box protein AGL30
TrEMBLA0A2H5N8Y10.0A0A2H5N8Y1_CITUN; Uncharacterized protein
STRINGXP_006483134.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM87542539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.25e-79AGAMOUS-like 30
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]