PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_30614_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family G2-like
Protein Properties Length: 398aa    MW: 42454.6 Da    PI: 8.4808
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_30614_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like521.6e-162352255
         G2-like 22 GGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    G ++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  Neem_30614_f_1  2 GHKKKAVPKKILELMNVPGLTRENVASHLQKYRL 35
                    6689*****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.3E-16240IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-14235IPR006447Myb domain, plants
SuperFamilySSF466897.53E-9439IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MGHKKKAVPK KILELMNVPG LTRENVASHL QKYRLYLRRL SGVSQHQSTT FISPQEPPYG  60
PLSSLNGLDI QALAATGQIP AQSLATLQAA GLGRSTAKPG LPMPLVDQRN LFSFDNQKIR  120
FGEAQPQHMN SGKQMNLLHG IPTTMEPKQL VNLHHSTQSL GGLNMPVSAH GGQSSQSNSL  180
LIQMTQPQAR GQILNENTVG QVPRLPTSMG QPILSNGVAS GILTRNGIGE SGRGTGYNSV  240
SQTSSMLNFP LNPPADLPGN SFPLRSLTFD ASQHSNTLQG NVDVAPSVLV NQGYSSSQRS  300
GQNSNASALG KAMFSVGEGS EHGNAQNVGQ HLNNLLVDNS MGVKAERVSD TSCPPTAFPQ  360
HFGQEDLMSA LLKQQQDGIG PAENEFEFDG YSLDNIPV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006419443.10.0two-component response regulator ARR2 isoform X1
RefseqXP_024047521.10.0two-component response regulator ARR2 isoform X3
TrEMBLV4RFQ40.0V4RFQ4_9ROSI; Two-component response regulator
STRINGXP_006419443.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24032773
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.21e-73response regulator 1