PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_3042_f_10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family ARF
Protein Properties Length: 698aa    MW: 77039 Da    PI: 6.6386
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_3042_f_10genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B378.95.2e-25143244199
                     EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     f k+ltpsd++++g +++pk++a+e+       ++++  ++l+ +d++g +W++++iyr++++r++lt+GW+ Fv +++L +gD ++F   + ++
  Neem_3042_f_10 143 FSKKLTPSDTSTHGGFSVPKRHADEClppldmAQDPPL-QELVANDLHGMEWRFRHIYRGQPKRHLLTSGWSVFVTSKKLVAGDACIFL--RGEN 234
                     88*****************************8444444.59************************************************..4499 PP

                     E..EEEEE-S CS
              B3  90 felvvkvfrk 99 
                     +el+v+v+r+
  Neem_3042_f_10 235 GELRVGVHRA 244
                     99****9986 PP

2Auxin_resp106.62.7e-35269351183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a ha+st+++F+v+Y+P++s++eF+v++++++++ ++ +svG+Rfkmafe+e++ e+r++Gtvvg++++d +rWp S+Wr+Lk
  Neem_3042_f_10 269 AFHAISTGTMFTVYYRPWTSPAEFIVPFNQYMRSAEIDYSVGTRFKMAFEGEECGEQRVAGTVVGIEAIDHIRWPASEWRCLK 351
                     689******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019365.62E-36134272IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.109.5E-40134256IPR015300DNA-binding pseudobarrel domain
CDDcd100176.24E-23141243No hitNo description
PfamPF023621.2E-22143244IPR003340B3 DNA binding domain
PROSITE profilePS5086312.52143245IPR003340B3 DNA binding domain
SMARTSM010191.9E-23143245IPR003340B3 DNA binding domain
PfamPF065076.6E-33269351IPR010525Auxin response factor
PfamPF023098.8E-7604682IPR033389AUX/IAA domain
PROSITE profilePS5174515.023613694IPR000270PB1 domain
SuperFamilySSF542773.09E-7617682No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 698 aa     Download sequence    Send to blast
MGGVGGEGKE SSTGVSQSRK RMGDALSTKH NQGGKDELYT ELWRACAGPL VYVPRAGDIV  60
YYFLQGHMEQ VEAYTSEDGK MEMPIYNLPP KILCEVVYVQ LKAEAGTDEV FAQITLLPKP  120
KDEPSLEDGD SLPSPPKANV WSFSKKLTPS DTSTHGGFSV PKRHADECLP PLDMAQDPPL  180
QELVANDLHG MEWRFRHIYR GQPKRHLLTS GWSVFVTSKK LVAGDACIFL RGENGELRVG  240
VHRAIKQQNN GSTSVISGHS MQHGILASAF HAISTGTMFT VYYRPWTSPA EFIVPFNQYM  300
RSAEIDYSVG TRFKMAFEGE ECGEQRVAGT VVGIEAIDHI RWPASEWRCL KVRWDAASDT  360
LMRPTRVSPW NIEQIVCNNK KPAPGQNRQK RQRSIDVSSP GFSSLLNNGV LQGQEDPENK  420
AVGIKELGAP KPPLLPYLVS HPNPDWGYMQ IRLENKLHLP IRDKLYLHPN STVSLSGGSI  480
VSSSFPNHWP AAFAPYGVHD NAALSRNFSV PNASSLSSGS QEWRTLELKD ENGTPHAEPK  540
GGSRYMLFGV NLVNSSPELP SPQVATSNEL ESLCSVPPTS QSSVSETIQV SELSKSVSGI  600
PSEKQCKNCC VSRSCTKVLK FGTALGRSVD LTRFHGYDEL IRELDQMFDF RGSLIDGSSG  660
WQIAYTDYEG DIMLIGDYPW QLSSKPAFII VAYANDLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1423637317353Auxin response factor 1
4ldw_A1e-1423637317353Auxin response factor 1
4ldw_B1e-1423637317353Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. Promotes flowering, stamen development, floral organ abscission and fruit dehiscence. Functions independently of ethylene and cytokinin response pathways. May act as a repressor of cell division and organ growth. {ECO:0000269|PubMed:12036261, ECO:0000269|PubMed:15960614, ECO:0000269|PubMed:16176952, ECO:0000269|PubMed:16339187}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024045602.10.0auxin response factor 2B
SwissprotQ94JM31e-164ARFB_ARATH; Auxin response factor 2
TrEMBLA0A067H8T00.0A0A067H8T0_CITSI; Auxin response factor
STRINGXP_006479861.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM157971016
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.31e-166auxin response factor 2
Publications ? help Back to Top
  1. Chao WS,Doğramaci M,Foley ME,Horvath DP,Anderson JV
    Selection and validation of endogenous reference genes for qRT-PCR analysis in leafy spurge (Euphorbia esula).
    PLoS ONE, 2012. 7(8): p. e42839
    [PMID:22916167]
  2. Ozerova LV,Krasnikova MS,Troitsky AV,Solovyev AG,Morozov SY
    TAS3 Genes for small ta-siARF RNAs in plants belonging to subtribe Senecioninae: occurrence of prematurely terminated RNA precursors.
    Mol. Gen. Mikrobiol. Virusol., 2013.
    [PMID:24003511]
  3. Li C, et al.
    Ectopic expression of a maize hybrid down-regulated gene ZmARF25 decreases organ size by affecting cellular proliferation in Arabidopsis.
    PLoS ONE, 2014. 9(4): p. e94830
    [PMID:24756087]
  4. Lyons R, et al.
    Fusarium oxysporum triggers tissue-specific transcriptional reprogramming in Arabidopsis thaliana.
    PLoS ONE, 2015. 10(4): p. e0121902
    [PMID:25849296]
  5. Roodbarkelari F,Du F,Truernit E,Laux T
    ZLL/AGO10 maintains shoot meristem stem cells during Arabidopsis embryogenesis by down-regulating ARF2-mediated auxin response.
    BMC Biol., 2015. 13: p. 74
    [PMID:26358077]
  6. Meng LS,Wang ZB,Yao SQ,Liu A
    The ARF2-ANT-COR15A gene cascade regulates ABA-signaling-mediated resistance of large seeds to drought in Arabidopsis.
    J. Cell. Sci., 2015. 128(21): p. 3922-32
    [PMID:26395398]
  7. Zhao S,Zhang ML,Ma TL,Wang Y
    Phosphorylation of ARF2 Relieves Its Repression of Transcription of the K+ Transporter Gene HAK5 in Response to Low Potassium Stress.
    Plant Cell, 2016. 28(12): p. 3005-3019
    [PMID:27895227]
  8. Promchuea S,Zhu Y,Chen Z,Zhang J,Gong Z
    ARF2 coordinates with PLETHORAs and PINs to orchestrate ABA-mediated root meristem activity in Arabidopsis .
    J Integr Plant Biol, 2017. 59(1): p. 30-43
    [PMID:28074634]
  9. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]
  10. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]
  11. Zhang M,Hu X,Zhu M,Xu M,Wang L
    Transcription factors NF-YA2 and NF-YA10 regulate leaf growth via auxin signaling in Arabidopsis.
    Sci Rep, 2017. 7(1): p. 1395
    [PMID:28469131]
  12. Guan C, et al.
    Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis.
    Curr. Biol., 2017. 27(19): p. 2940-2950.e4
    [PMID:28943086]
  13. Liu Z, et al.
    ARF2-ARF4 and ARF5 are Essential for Female and Male Gametophyte Development in Arabidopsis.
    Plant Cell Physiol., 2018. 59(1): p. 179-189
    [PMID:29145642]
  14. Sarkar Das S, et al.
    Expression dynamics of miRNAs and their targets in seed germination conditions reveals miRNA-ta-siRNA crosstalk as regulator of seed germination.
    Sci Rep, 2018. 8(1): p. 1233
    [PMID:29352229]