PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_30344_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family LBD
Protein Properties Length: 255aa    MW: 29029.6 Da    PI: 4.9763
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_30344_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.12e-40181171100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rrkCa+dC+lapyfp++++++f n+hklFG+sn++k++k+l++  +++am+++++++++ra+dPv G++++i++lq+q+e  kael+
  Neem_30344_f_1  18 ACAACKYQRRKCAPDCILAPYFPHDRQRQFLNAHKLFGVSNITKIIKTLEPPAKDEAMRTIIFQSDVRASDPVGGCYRIIRELQRQIEYNKAELE 112
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                     l+ ++
  Neem_30344_f_1 113 LVLHQ 117
                     98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512575119No hitNo description
PROSITE profilePS5089124.92517118IPR004883Lateral organ boundaries, LOB
PfamPF031952.4E-3718114IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MSNIPRIGSS NGATTTQACA ACKYQRRKCA PDCILAPYFP HDRQRQFLNA HKLFGVSNIT  60
KIIKTLEPPA KDEAMRTIIF QSDVRASDPV GGCYRIIREL QRQIEYNKAE LELVLHQLAI  120
FRAQTQQQPQ NPLQMPETDD SVLSYEIMNA AAEPLNVQNY TYNVQPTPTQ QQNQELVNVR  180
NQLQQEEDVN AWAMQDPTIL STLNVNNDNG ISSNDDVKPQ FVEIPCERHD VKFEQDQEGL  240
VERRFVPSTQ LLISS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006466020.11e-119PREDICTED: LOB domain-containing protein 22
SwissprotQ9LRW12e-67LBD22_ARATH; LOB domain-containing protein 22
TrEMBLA0A0D2VJ031e-88A0A0D2VJ03_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64982645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.12e-61LOB domain-containing protein 22