PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_30223_a_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 67aa    MW: 7772.11 Da    PI: 10.6673
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_30223_a_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.65.8e-32959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krienk+nrqvtf+kRrng+lKKA+ELS+LCdaev +iifss+gklye++s
  Neem_30223_a_2  9 KRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVGLIIFSSRGKLYEFCS 59
                    79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.0E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.983161IPR002100Transcription factor, MADS-box
CDDcd002653.59E-38266No hitNo description
SuperFamilySSF554557.33E-31264IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-33323IPR002100Transcription factor, MADS-box
PfamPF003192.7E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-333859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 67 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSILCD AEVGLIIFSS RGKLYEFCSN  60
SRSMVYN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A4e-20165165MEF2C
5f28_B4e-20165165MEF2C
5f28_C4e-20165165MEF2C
5f28_D4e-20165165MEF2C
6byy_A4e-20165165MEF2 CHIMERA
6byy_B4e-20165165MEF2 CHIMERA
6byy_C4e-20165165MEF2 CHIMERA
6byy_D4e-20165165MEF2 CHIMERA
6bz1_A4e-20165165MEF2 CHIMERA
6bz1_B4e-20165165MEF2 CHIMERA
6bz1_C4e-20165165MEF2 CHIMERA
6bz1_D4e-20165165MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMADS-box transcription factor that acts redundantly with J2 to control meristem maturation and inflorescence architecture. {ECO:0000269|PubMed:28528644}.
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027099546.13e-35agamous-like MADS-box protein AGL9 homolog isoform X1
RefseqXP_027099548.12e-35agamous-like MADS-box protein AGL9 homolog isoform X3
RefseqXP_027154053.12e-35agamous-like MADS-box protein AGL9 homolog isoform X1
RefseqXP_028764889.13e-35developmental protein SEPALLATA 1-like isoform X1
SwissprotQ7Y0406e-35EJ2_SOLLC; MADS-box protein EJ2
SwissprotQ8LLR24e-35MADS2_VITVI; Agamous-like MADS-box protein MADS2
TrEMBLA0A2N9HF953e-35A0A2N9HF95_FAGSY; Uncharacterized protein
STRINGcassava4.1_033922m4e-36(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.35e-37MIKC_MADS family protein
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  4. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]
  5. Soyk S, et al.
    Bypassing Negative Epistasis on Yield in Tomato Imposed by a Domestication Gene.
    Cell, 2017. 169(6): p. 1142-1155.e12
    [PMID:28528644]