PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_28515_f_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HB-other
Protein Properties Length: 445aa    MW: 49675.2 Da    PI: 7.7875
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_28515_f_3genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.61.2e-09387441357
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                     kR+++  eq++ L+  F + + ++ +++ +L+++ gL  +qV+vWF+Nr a ek+
  Neem_28515_f_3 387 KRRKLGIEQVQLLKLNFGNYHQLKFDRKGQLSSEHGLYPCQVSVWFHNRSACEKR 441
                     7889999******************************************988886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF070005.9E-5238369IPR010733Protein of unknown function DUF1308
PROSITE profilePS5007110.544382442IPR001356Homeobox domain
SuperFamilySSF466892.1E-7384441IPR009057Homeodomain-like
CDDcd000866.00E-5387443No hitNo description
PfamPF000467.1E-7387441IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.4E-8388442IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MEEAEAIKRR CRDAIHRIER LPSSTKITES CKKTLLRLAN SELNFFSRLT SPIPLSSNIG  60
HLEAVVFVLQ QPFITGISRV CKTIRNGLKS VHVDVVCTLN KNPVWIIVSD RNPRYISWNG  120
CPKNKGLKLR VEEILAAAGT SQSLKPFSVI LFFSNGLGNF VRERLCNEFG ASEVSLSEFE  180
FCEEVEDEWI NVHPRLFDEA CVLEIKLDFT GNDVLNSECG VKNLVIAAAA FNLEEKNTEV  240
NLGDAFGSLL SRMKLSSLGE PDHLLNGVDL INFDTTALIA LVSGISNGCA EKILATPDIE  300
LRQQFKGNTQ FVIAQAMSEV QSPIDEELGG VIAGKRGMIC ESVLSEFKEL VLMCGGPNEK  360
LRADELLKFF IWRKKNKGAQ TNITSAKRRK LGIEQVQLLK LNFGNYHQLK FDRKGQLSSE  420
HGLYPCQVSV WFHNRSACEK RSHSG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1372389RKKNKGAQTNITSAKRRK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006441476.10.0uncharacterized protein LOC18050013 isoform X2
RefseqXP_006441482.10.0uncharacterized protein LOC18050013 isoform X2
TrEMBLV4TMU00.0V4TMU0_9ROSI; Uncharacterized protein
TrEMBLV4VP930.0V4VP93_9ROSI; Uncharacterized protein
STRINGXP_006441476.10.0(Citrus clementina)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.14e-12homeobox protein 40