PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_2841_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family TALE
Protein Properties Length: 684aa    MW: 75162.8 Da    PI: 7.8845
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_2841_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.23.9e-103754121954
                    HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
       Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                    Fe   ++yp+ ++++ LAk++gLt +qV++WF N R +
  Neem_2841_f_1 375 FEHflHPYPKDSDKQMLAKQTGLTRSQVSNWFINARVR 412
                    554459******************************88 PP

2BELL125.32.4e-40239310172
           BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                    erqe+q+kkakL+++l+eV++rY+qy++q+q+vissFe++ag+gsak Yt+lAlk+iS++FrcLkdai++qi
  Neem_2841_f_1 239 ERQEIQMKKAKLINMLDEVEQRYRQYHHQMQIVISSFEQAAGIGSAKTYTALALKTISKQFRCLKDAITGQI 310
                    79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005749.7E-66162308IPR006563POX domain
PfamPF075263.1E-50167307IPR006563POX domain
PROSITE profilePS5007112.39353416IPR001356Homeobox domain
SMARTSM003894.3E-10356420IPR001356Homeobox domain
CDDcd000862.62E-12356417No hitNo description
SuperFamilySSF466896.42E-17357422IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.7E-29359422IPR009057Homeodomain-like
PfamPF059201.3E-18373412IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 684 aa     Download sequence    Send to blast
MATYFPGNPA ELQAQDGLQT LVLMNPTTYV QHQQQFSDAT PPPTQHNNLI FLNSSALSPH  60
APPPPTHTQH FVGIPTTNHD DTISSLHGLL PRVHYNLYNP NYPTPTARDT PRAKQGLSLS  120
LSSQQQAGYG SQGGQAQAVS GEDMRVSGGS ASSGSGVTNG VSGMHSVLLS SKYLKAAQEL  180
LDEVVNVNNS GINIKSELSK KGNGNNNSSS NKVIGESSAA AGDEGEAPGK RAAELTTAER  240
QEIQMKKAKL INMLDEVEQR YRQYHHQMQI VISSFEQAAG IGSAKTYTAL ALKTISKQFR  300
CLKDAITGQI RSANKMLGEE DCLGGKIEGS RLKFVDNHLR QQRALQQLGM IQHNAWRPQR  360
GLPERSVSVL RAWLFEHFLH PYPKDSDKQM LAKQTGLTRS QVSNWFINAR VRLWKPMVEE  420
MYLEEIKEHE QNGSEDKTSK SEHNEDSASK SSARQEKNLV SEKQNAKNFK SNTDNSTNQN  480
VHSAISMSTV PTSPIGRNVR HPSGFSLIGS SELEGLTQGS PKKPRNTEML QSPSSMPPTI  540
NMDIKPGGEP DNDQISMKFD DDRQSRDGYS FIGNQMNFIQ GFGQYPIGEI GRFDAEQFTP  600
RFSGNGVSLT LGLPHCENLS LSATHQTFLP SQNIQLGRRV EIGEANEFGA MNTTPPHSSA  660
AAYENLNIQN RKRFAAQLLP DFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A3e-16362420563Homeobox protein Meis2
3k2a_B3e-16362420563Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006481599.10.0BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A067FTF20.0A0A067FTF2_CITSI; Uncharacterized protein
STRINGXP_006481599.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.30.0BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]