PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_2759_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family LBD
Protein Properties Length: 143aa    MW: 16075.5 Da    PI: 9.6368
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_2759_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.93e-4242139198
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i++lqqq+++l+ael++
  Neem_2759_f_1  42 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVPESQRADAANSLVYEANVRLRDPVYGCMGAISALQQQVQSLQAELNA 137
                    7*********************************************************************************************98 PP

         DUF260  97 lk 98 
                     k
  Neem_2759_f_1 138 EK 139
                    76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.73641142IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-4242138IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MSRERERFDE IGKKIKREAD ASSHMGRRHM LGPPGTLNTI TPCAACKLLR RRCAQECPFS  60
PYFSPHEPQK FASVHKVFGA SNVSKMLMEV PESQRADAAN SLVYEANVRL RDPVYGCMGA  120
ISALQQQVQS LQAELNAEKK WKP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012091188.18e-98PREDICTED: LOB domain-containing protein 15
SwissprotQ8L5T58e-80LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A067JNV99e-98A0A067JNV9_JATCU; Uncharacterized protein
STRINGVIT_13s0067g02380.t011e-95(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.14e-79LOB domain-containing protein 15