PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_26911_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family G2-like
Protein Properties Length: 361aa    MW: 40519 Da    PI: 9.0553
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_26911_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.83.9e-3171124255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     prlrWtpeLH +Fv+ave+LGG+e+AtPk +l++m++kgL ++hvkSHLQ+YR 
  Neem_26911_f_1  71 PRLRWTPELHLCFVHAVERLGGQERATPKLVLQFMDIKGLNISHVKSHLQMYRN 124
                     8****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.54767127IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2867125IPR009057Homeodomain-like
SuperFamilySSF466891.97E-1468125IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-2271126IPR006447Myb domain, plants
PfamPF002497.7E-872123IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MKGIDSSERS KTSNSNETGS EDEREEIDKT CQSISGESSS NSSIELENEN KKTPAAGYSG  60
STRQYNRSKT PRLRWTPELH LCFVHAVERL GGQERATPKL VLQFMDIKGL NISHVKSHLQ  120
MYRNKKLDEP NQVLNGVSDK FRTLKGSFFH SRCGDVAAWR RYGSQTCSFG LGENNAVGKA  180
KHGLYASVAE RLLGTQNTKL NLHSHTASTC SFNEQDTSKT HQTFEEVDEL IRRFRQSHST  240
SRPSSSMERN FKTQVEERVK GQINCSKKNS SHHCNSWPMV QEAENKLKRK TWDSECNIDL  300
NLSLKIKPTI DEVLEGAEAQ STSLSLSLSS SSSSKISRLK EGYESRKQEK TTAASTLDLT  360
L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-1672126458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-1672126458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A9e-1772126357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B9e-1772126357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C9e-1772126357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D9e-1772126357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-1672126458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-1672126458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-1672126458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-1672126458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-1672126458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-1672126458Protein PHOSPHATE STARVATION RESPONSE 1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006486285.14e-84uncharacterized protein LOC102620939
RefseqXP_024041316.14e-84uncharacterized protein LOC18044186
TrEMBLA0A2H5NJW41e-82A0A2H5NJW4_CITUN; Uncharacterized protein
STRINGXP_006486285.12e-83(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.11e-37G2-like family protein