PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_26765_a_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 69aa    MW: 7862.24 Da    PI: 10.4599
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_26765_a_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF102.61.4e-32958150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    k ienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+iifss+gklye+ 
  Neem_26765_a_1  9 KTIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFG 58
                    68**********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.6E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.983161IPR002100Transcription factor, MADS-box
CDDcd002657.38E-38261No hitNo description
SuperFamilySSF554558.76E-31261IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-33323IPR002100Transcription factor, MADS-box
PfamPF003194.2E-281157IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-333859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 69 aa     Download sequence    Send to blast
MGRGRVELKT IENKINRQVT FSKRRNGLLK KAYELSVLCD AEVALIIFSS RGKLYEFGSS  60
GYIFVLFSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A1e-20167167MEF2C
5f28_B1e-20167167MEF2C
5f28_C1e-20167167MEF2C
5f28_D1e-20167167MEF2C
6byy_A1e-20167167MEF2 CHIMERA
6byy_B1e-20167167MEF2 CHIMERA
6byy_C1e-20167167MEF2 CHIMERA
6byy_D1e-20167167MEF2 CHIMERA
6bz1_A1e-20167167MEF2 CHIMERA
6bz1_B1e-20167167MEF2 CHIMERA
6bz1_C1e-20167167MEF2 CHIMERA
6bz1_D1e-20167167MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
UniProtProbable transcription factor. Regulates floral organ identity and floral meristem determinacy. May be involved in the control of flowering time. {ECO:0000269|PubMed:19820190, ECO:0000269|Ref.8}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017625225.16e-37PREDICTED: agamous-like MADS-box protein AGL6 isoform X5
SwissprotQ6EU398e-35MADS6_ORYSJ; MADS-box transcription factor 6
SwissprotQ8LLR17e-35MADS3_VITVI; Agamous-like MADS-box protein MADS3
TrEMBLA0A1U8IVN12e-35A0A1U8IVN1_GOSHI; agamous-like MADS-box protein AGL6 isoform X1
TrEMBLA0A287EAW52e-35A0A287EAW5_HORVV; Uncharacterized protein
TrEMBLA0A287UH152e-35A0A287UH15_HORVV; Uncharacterized protein
STRINGPavir.Ab02707.1.p2e-34(Panicum virgatum)
STRINGORGLA02G0240800.11e-35(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45650.12e-36AGAMOUS-like 6
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  3. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  4. Li H, et al.
    The AGL6-like gene OsMADS6 regulates floral organ and meristem identities in rice.
    Cell Res., 2010. 20(3): p. 299-313
    [PMID:20038961]
  5. Zhang J,Nallamilli BR,Mujahid H,Peng Z
    OsMADS6 plays an essential role in endosperm nutrient accumulation and is subject to epigenetic regulation in rice (Oryza sativa).
    Plant J., 2010. 64(4): p. 604-17
    [PMID:20822505]
  6. Seok HY, et al.
    Rice ternary MADS protein complexes containing class B MADS heterodimer.
    Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604
    [PMID:20888318]
  7. Li H, et al.
    Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate.
    Plant Cell, 2011. 23(7): p. 2536-52
    [PMID:21784949]
  8. Yadav SR,Khanday I,Majhi BB,Veluthambi K,Vijayraghavan U
    Auxin-responsive OsMGH3, a common downstream target of OsMADS1 and OsMADS6, controls rice floret fertility.
    Plant Cell Physiol., 2011. 52(12): p. 2123-35
    [PMID:22016342]
  9. Duan Y, et al.
    Characterization of Osmads6-5, a null allele, reveals that OsMADS6 is a critical regulator for early flower development in rice (Oryza sativa L.).
    Plant Mol. Biol., 2012. 80(4-5): p. 429-42
    [PMID:22933119]
  10. Conrad LJ, et al.
    The polycomb group gene EMF2B is essential for maintenance of floral meristem determinacy in rice.
    Plant J., 2014. 80(5): p. 883-94
    [PMID:25279942]
  11. Zhang J, et al.
    Down-regulation of a LBD-like gene, OsIG1, leads to occurrence of unusual double ovules and developmental abnormalities of various floral organs and megagametophyte in rice.
    J. Exp. Bot., 2015. 66(1): p. 99-112
    [PMID:25324400]
  12. Bai X, et al.
    Regulatory role of FZP in the determination of panicle branching and spikelet formation in rice.
    Sci Rep, 2016. 6: p. 19022
    [PMID:26744119]
  13. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]
  14. Zhang B, et al.
    A High Temperature-Dependent Mitochondrial Lipase EXTRA GLUME1 Promotes Floral Phenotypic Robustness against Temperature Fluctuation in Rice (Oryza sativa L.).
    PLoS Genet., 2016. 12(7): p. e1006152
    [PMID:27367609]