PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_26712_f_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family CPP
Protein Properties Length: 656aa    MW: 71493.1 Da    PI: 8.4027
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_26712_f_4genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR461.1e-14165204242
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                     ++k+CnC++s+Clk+YCeCfaag +C+  C+C +C+N+ e+
  Neem_26712_f_4 165 KQKQCNCRNSRCLKLYCECFAAGIYCDG-CNCINCHNNVEH 204
                     89**************************.********9876 PP

2TCR50.54.2e-16266305140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Neem_26712_f_4 266 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCLDCKNFE 305
                     589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011147.4E-19164204IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.733165306IPR005172CRC domain
PfamPF036389.5E-12166201IPR005172CRC domain
SMARTSM011141.5E-19266307IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.3E-12269304IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 656 aa     Download sequence    Send to blast
MEQEISEAIG FHHVPSISKR HIAGAVGKLT VTAVTDSIAE QSVNSQSQQS QTQSHSVLQA  60
QPKSQQQVQS QAASQSQSQS QPLVPSQLLP PSQQQSSHPQ VQSQMKSPLQ AMPQRQARPQ  120
QMRMVQRVPH PVHKLPLPTL HAVKQESPRS RPWGSIEAKD GTPKKQKQCN CRNSRCLKLY  180
CECFAAGIYC DGCNCINCHN NVEHEAARQE AVGATLERNP NAFRPKIASS PHGSQDARKQ  240
SIFSPDPCPH PSTQKEDARE AQLAAKHNKG CHCKKSGCLK KYCECFQANI LCSENCKCLD  300
CKNFEGSEER RALFHGDHNA IAFMQKAANA AINGAVGSSG YGTPLASNKR KSEELSFGVT  360
AKDHLINRNA QSQQGNHLRN CAVPSSQSFP VSWTANAAVL GSSKSALRSP LADILQPQDM  420
KELCSFLVIV SSEATKTLTE KAGKTDRQKS TTVASSIQDS EDGKKGNAVH NGVPDDRLSG  480
NQMDVDRTSG SGSDAGDLLN ERPLSPGTRA LMCDEEDTVF MSAGPPTGLA NHCKNTNQKS  540
NGYESTRFYA EQERLILTRF RDFLNRLITC GSIKETMCSP LVKSETRTQQ KPVEDGTIRA  600
GTEARRYKEL YDDACPRSAV PMTVESSQTV STVTATHNND LPMKIGLPIG NGFDGF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A5e-311573152132Protein lin-54 homolog
5fd3_B5e-311573152132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006476073.10.0protein tesmin/TSO1-like CXC 5 isoform X2
SwissprotQ9SZD11e-144TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A067GJ650.0A0A067GJ65_CITSI; Uncharacterized protein
STRINGXP_006476073.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-145Tesmin/TSO1-like CXC domain-containing protein