PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_25813_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family YABBY
Protein Properties Length: 129aa    MW: 14121.2 Da    PI: 6.7323
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_25813_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY592e-181456547
           YABBY  5 ssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtslls 47
                      se++Cyv+CnfCnt+lav +P + l+ +vtv+CGhC++l  
  Neem_25813_f_1 14 PPSEHLCYVRCNFCNTVLAVGIPCKRLLDTVTVKCGHCSNLSF 56
                    579************************************9854 PP

2YABBY50.21e-1574102135163
           YABBY 135 eeiqrikasnPdishreafsaaaknWahf 163
                     eeiqrika+nP+i hreafs+aaknWa +
  Neem_25813_f_1  74 EEIQRIKAANPEIPHREAFSTAAKNWARY 102
                     9**************************76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046901.9E-191562IPR006780YABBY protein
PfamPF046902.5E-1474102IPR006780YABBY protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010254Biological Processnectary development
GO:0010582Biological Processfloral meristem determinacy
GO:0048479Biological Processstyle development
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MSLEENISMD LQVPPSEHLC YVRCNFCNTV LAVGIPCKRL LDTVTVKCGH CSNLSFLSTK  60
PPQQGPCQMS LTFEEIQRIK AANPEIPHRE AFSTAAKNWA RYIPNSLTGS SSGSSSNLPE  120
AEAALIYAF
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for the initiation of nectary development. Also involved in suppressing early radial growth of the gynoecium, in promoting its later elongation and in fusion of its carpels by regulating both cell division and expansion. Establishes the polar differentiation in the carpels by specifying abaxial cell fate in the ovary wall. Regulates both cell division and expansion. {ECO:0000269|PubMed:10225997, ECO:0000269|PubMed:10225998, ECO:0000269|PubMed:10535738, ECO:0000269|PubMed:11714690, ECO:0000269|PubMed:15598802, ECO:0000269|Ref.10}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00220DAPTransfer from AT1G69180Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by SPT and by A class genes AP2 and LUG in the outer whorl. In the third whorl, B class genes AP3 and PI, and the C class gene AG act redundantly with each other and in combination with SEP1, SEP2, SEP3, SHP1 and SHP2 to activate CRC in nectaries and carpels. LFY enhances its expression. {ECO:0000269|PubMed:10225998, ECO:0000269|PubMed:15598802}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006484236.12e-65protein CRABS CLAW
SwissprotQ8L9255e-42CRC_ARATH; Protein CRABS CLAW
TrEMBLA0A2H5NVV62e-64A0A2H5NVV6_CITUN; Uncharacterized protein
STRINGXP_006484236.16e-65(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM97252835
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69180.12e-41YABBY family protein
Publications ? help Back to Top
  1. Fourquin C,Primo A,Martínez-Fernández I,Huet-Trujillo E,Ferrándiz C
    The CRC orthologue from Pisum sativum shows conserved functions in carpel morphogenesis and vascular development.
    Ann. Bot., 2014. 114(7): p. 1535-44
    [PMID:24989787]
  2. Pfannebecker KC,Lange M,Rupp O,Becker A
    Seed Plant-Specific Gene Lineages Involved in Carpel Development.
    Mol. Biol. Evol., 2017. 34(4): p. 925-942
    [PMID:28087776]
  3. Yamaguchi N,Huang J,Xu Y,Tanoi K,Ito T
    Fine-tuning of auxin homeostasis governs the transition from floral stem cell maintenance to gynoecium formation.
    Nat Commun, 2017. 8(1): p. 1125
    [PMID:29066759]
  4. Yamaguchi N, et al.
    Chromatin-mediated feed-forward auxin biosynthesis in floral meristem determinacy.
    Nat Commun, 2018. 9(1): p. 5290
    [PMID:30538233]