PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_2555_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family VOZ
Protein Properties Length: 482aa    MW: 54324.4 Da    PI: 7.0539
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_2555_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ411.12.1e-1262134291217
            VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelf 96 
                    pppsaf+gpkcalwdctrpa g+ew++dycssfhatla++e++pg++pvlrp+gi+lkd+llf+a++ak+qgk+vgip+cegaat+k+pwna+e+f
  Neem_2555_f_1 213 PPPSAFMGPKCALWDCTRPALGFEWYKDYCSSFHATLAVHEDSPGISPVLRPGGINLKDSLLFNAVNAKAQGKNVGIPHCEGAATTKCPWNATEIF 308
                    89********************************************************************************************** PP

            VOZ  97 dlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvde 192
                    d+sll+getirewlffdk rrafesg rkqrslpd+ grgwhesrkqvmke+gg+krsyymdpqps+ fewhlyeye+n +d++alyrlelk++ +
  Neem_2555_f_1 309 DISLLKGETIREWLFFDKHRRAFESGTRKQRSLPDHVGRGWHESRKQVMKEYGGQKRSYYMDPQPSDGFEWHLYEYEVNGYDEYALYRLELKISIG 404
                    ************************************************************************************************ PP

            VOZ 193 kksakgkvskdsladlqkklgrlta 217
                    kks+kgk +kdsladlqkk+g+lta
  Neem_2555_f_1 405 KKSPKGKATKDSLADLQKKMGQLTA 429
                    ***********************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
MEQKVSMQSG SKSKCASASH QLLLENAKNR LSDLQDRFAN LRAARKERRP NDVAVLEEQV  60
YQILREWNSE LTAPSPACSL LGGSLGSFSN DIDRLLQLCE EQDDATSPLA GLVDLKPQPD  120
VQGLHPGTMM PLQEDYLVNN ELQGDCFQEF DNCRDSTSGL HNSAVGISEL TTRLDYYHLN  180
LRQELEQVVL DGNRGTEECE KDVGPNILSN ILPPPSAFMG PKCALWDCTR PALGFEWYKD  240
YCSSFHATLA VHEDSPGISP VLRPGGINLK DSLLFNAVNA KAQGKNVGIP HCEGAATTKC  300
PWNATEIFDI SLLKGETIRE WLFFDKHRRA FESGTRKQRS LPDHVGRGWH ESRKQVMKEY  360
GGQKRSYYMD PQPSDGFEWH LYEYEVNGYD EYALYRLELK ISIGKKSPKG KATKDSLADL  420
QKKMGQLTAE VSPDNKSAVK GQTDNKVKVD STNVVCRRRW DSSLLRFRQI INLLLRARRI  480
IK
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006469061.10.0transcription factor VOZ1
SwissprotQ9SGQ01e-170VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A067DW120.0A0A067DW12_CITSI; Uncharacterized protein
STRINGXP_006469061.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM110602534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-160vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]