PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_25293_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family ARF
Protein Properties Length: 414aa    MW: 46528 Da    PI: 8.9607
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_25293_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.21.8e-24123223198
                     EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                     f+kvlt sd++++g +++ +k+a+e+     +++++ +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF   + +++
  Neem_25293_f_1 123 FCKVLTASDTSTHGGFSVLRKHATEClppldMNQSTPTQELVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLAAGDTFVFL--RGENG 215
                     99****************************9445555669************************************************..44999 PP

                     ..EEEEE- CS
              B3  91 elvvkvfr 98 
                     el+v v+r
  Neem_25293_f_1 216 ELRVAVRR 223
                     99**9997 PP

2Auxin_resp107.12e-35249328183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a+ha++t+++F v+Y+Pr+  s+F++ ++k+++a+++k++vGmR+km+fe+eds+err+sGt+vgv+d++p +W++SkWrsLk
  Neem_25293_f_1 249 ASHAVATQTMFVVYYKPRT--SQFIIGLNKYLEAVNNKFTVGMRYKMRFEGEDSPERRFSGTIVGVEDFSP-HWQDSKWRSLK 328
                     789***************6..9*************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.109.5E-41114238IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.11E-38116252IPR015300DNA-binding pseudobarrel domain
CDDcd100177.79E-21121223No hitNo description
SMARTSM010192.1E-22123225IPR003340B3 DNA binding domain
PfamPF023623.0E-22123223IPR003340B3 DNA binding domain
PROSITE profilePS5086312.576123225IPR003340B3 DNA binding domain
PfamPF065071.2E-32249328IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MANRVGSLSQ PCSSSDDLYV ELWKACAGPL VDVPKQGERV YYFPQGHMEQ LEASTNQELN  60
QRIPLFHLPS KILCRVIHIQ LLAEQETDEV YAQITLLPEP SQQEPTTPDP CPSESPRPTL  120
RSFCKVLTAS DTSTHGGFSV LRKHATECLP PLDMNQSTPT QELVAKDLHG YEWRFKHIFR  180
GQPRRHLLTT GWSTFVTSKR LAAGDTFVFL RGENGELRVA VRRLAHQQSS MPSSVISSQS  240
MHLGVLATAS HAVATQTMFV VYYKPRTSQF IIGLNKYLEA VNNKFTVGMR YKMRFEGEDS  300
PERRFSGTIV GVEDFSPHWQ DSKWRSLKVQ WDEPASITRP DRVSPWDLEP FVASAASNLV  360
QPVLAKNKRA PDRVSPWDLE PFVASAASNL VQPVLAKNKR ARPAIELPAV GIRK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1771535716361Auxin response factor 1
4ldw_A1e-1771535716361Auxin response factor 1
4ldw_B1e-1771535716361Auxin response factor 1
4ldx_A1e-1771535716361Auxin response factor 1
4ldx_B1e-1771535716361Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006439306.10.0auxin response factor 9 isoform X2
RefseqXP_006476351.10.0auxin response factor 9 isoform X2
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLV4TRL70.0V4TRL7_9ROSI; Auxin response factor
STRINGXP_006439306.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9