PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_25056_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family LBD
Protein Properties Length: 149aa    MW: 16296.6 Da    PI: 8.1208
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_25056_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601491.2e-46131121100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca+dCv+apyfpa++p+kfa vhk+FGasnv k+l++lpe++r+da+ss+vyeA+ar+rdPvyG+vg i++lqqq+++l+++la
  Neem_25056_f_1  13 PCAACKLLRRRCAQDCVFAPYFPADEPQKFASVHKVFGASNVNKMLQELPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDSLQTQLA 107
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     l+++e
  Neem_25056_f_1 108 LAQAE 112
                     99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.29512113IPR004883Lateral organ boundaries, LOB
PfamPF031957.1E-4613110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MKESGRKQGA LSPCAACKLL RRRCAQDCVF APYFPADEPQ KFASVHKVFG ASNVNKMLQE  60
LPEHQRSDAV SSMVYEANAR VRDPVYGCVG AISSLQQQID SLQTQLALAQ AEVVHMRMRQ  120
YSPSSANNLP GNSMDMVDQA SIGGSLWSC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002513395.12e-93PREDICTED: LOB domain-containing protein 4
SwissprotQ9SHE98e-76LBD4_ARATH; LOB domain-containing protein 4
TrEMBLB9RI262e-93B9RI26_RICCO; LOB domain-containing protein, putative
STRINGPOPTR_0007s08290.15e-90(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.11e-69LOB domain-containing protein 4