PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_2426_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family GeBP
Protein Properties Length: 302aa    MW: 34188 Da    PI: 9.1148
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_2426_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57389.54.1e-28108199398
         DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWgs 98 
                    f ++ws+eDe+vlL+G++ f +++gk+p++++++f++f++ s++ ++sk+q+++K+rrLKkK+ ++ +k   gk++   ++h++  f+ls +iWg+
  Neem_2426_f_2 108 FGKIWSDEDEVVLLKGVLRFIQEKGKEPKSNVQEFHDFISASLQRNFSKTQVSDKLRRLKKKYSNNAAK---GKSV-SINHHEKVLFDLSTSIWGT 199
                    789*****************************************************************9...6664.557899***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.8E-26109198IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MNLKANTHGR WLRMQMTCAM VIVKIFFDAP RPFATVKDGE VVEDGADMMV VVGGAIMKQQ  60
GVIGCATASS NSRHEHDDDH SSNKKQRAIV DHDLDVHQNH EPKRVSSFGK IWSDEDEVVL  120
LKGVLRFIQE KGKEPKSNVQ EFHDFISASL QRNFSKTQVS DKLRRLKKKY SNNAAKGKSV  180
SINHHEKVLF DLSTSIWGTI CINNIERKPA VKAEAYYTNR RSAVVSGVVG SIFTEFLRSS  240
NLSYGEDLMK KYATGLIGNH ERNEEREKKW VKVAIQELEL LTTKCDLLNE EVTALLEILR  300
SQ
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.12e-17DNA-binding storekeeper protein-related transcriptional regulator