PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_23824_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family G2-like
Protein Properties Length: 397aa    MW: 44088.6 Da    PI: 8.3656
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_23824_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.71.1e-32252307156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Neem_23824_f_1 252 KQRRCWSPELHRRFVSALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 307
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.93E-18249310IPR009057Homeodomain-like
PROSITE profilePS5129413.66249309IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-29250310IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-26252307IPR006447Myb domain, plants
PfamPF002499.4E-8254305IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MGTVSPELSL DFRPTFVPKT ITDFLRDVSM IGNVSEKVSK LDGFVKGLEE EMRKIDAFKR  60
ELPLCMLLLN DAILVLKEES MQCITASKKV QPVLEEFIPL KKNNCEDEDE DVSPIKKEKD  120
SSKDNKKNWM SSVQLWNTDD HQTSDPLFET KQNPNLKIKR NEEENPLQAC KGAGTRAFMP  180
FKTYPVFAKK EEKGELPVHG LSLVTPGMKN PREDTGSSGS RTSCSKSVSS APNVQSNLRT  240
GPHLPQQQTT RKQRRCWSPE LHRRFVSALQ QLGGSQVATP KQIRELMQVD GLTNDEVKSH  300
LQKYRLHTRR TPSATSPAPA NQSTVVLGSL WMAQDRYGES SKASSSQSGS PQGPLQLGGN  360
TGGTSTTGGD SMEDDEDAKS EGYSWKSHIH RPGKDNV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-13252305255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-13252305255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-13252305154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-13252305154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-13252305154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-13252305154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-13252305255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-13252305255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-13252305255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-13252305255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-13252305255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-13252305255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00193DAPTransfer from AT1G49560Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1475971e-65EF147597.1 Populus trichocarpa clone WS0123_L02 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006480140.10.0transcription factor HHO2-like
TrEMBLA0A2H5Q0P00.0A0A2H5Q0P0_CITUN; Uncharacterized protein
STRINGXP_006480140.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM145351021
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.15e-55G2-like family protein