PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_23775_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family G2-like
Protein Properties Length: 357aa    MW: 40723.9 Da    PI: 8.2804
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_23775_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.64.5e-31179233155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     k+r+rWt++LH+rFve+v+ LGG+e+AtPk il+lm+++gLt+ hvkSHLQkYR+
  Neem_23775_f_2 179 KTRIRWTEDLHNRFVECVDLLGGAERATPKGILKLMDIDGLTIFHVKSHLQKYRI 233
                     68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.709176236IPR017930Myb domain
SuperFamilySSF466891.97E-17177233IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-27178234IPR009057Homeodomain-like
TIGRFAMsTIGR015577.6E-24179233IPR006447Myb domain, plants
PfamPF002495.2E-7183232IPR001005SANT/Myb domain
PfamPF143792.8E-19265312IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MDTQERKIQE KNYTYISSDR QQRWNKGIWF QSQFPKLNPG SSNGSGNIIS SNFGLPTSGF  60
YSADNCMDFP LGHCNIIDGL PAYSQNDFKG FHLIQSSAAK FQLQDHQIPN FSAKSHLDCY  120
RNSPGSVLSF MQKPAEESES NLMNQRQNYI PKPSSSYLQS QRQQPTNACF VPAAAITSKT  180
RIRWTEDLHN RFVECVDLLG GAERATPKGI LKLMDIDGLT IFHVKSHLQK YRIARHIPES  240
TEGKSKSERT TDINAIVRLD PKTGMQLVET LRLQLDVQKR LHEQLEVQRN LQLQIEEQGK  300
RLKKMLEQQL KTKESLINDT HDLDNTLQDT PPNDVCTFNI QGFKDTQLYP SNNVVCS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A8e-24179236259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B8e-24179236259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A9e-24179236158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B9e-24179236158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C9e-24179236158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D9e-24179236158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A8e-24179236259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C8e-24179236259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D8e-24179236259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F8e-24179236259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H8e-24179236259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J8e-24179236259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015387141.21e-117myb family transcription factor PHL5-like
TrEMBLA0A2H5NAE01e-116A0A2H5NAE0_CITUN; Uncharacterized protein
STRINGXP_006483673.11e-117(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54762748
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.12e-63G2-like family protein