PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_23394_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family WRKY
Protein Properties Length: 159aa    MW: 18172.8 Da    PI: 5.1031
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_23394_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.91.5e-3198156159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDg++WrKYG+K+vk+s++pr+YY+C+  gCpvkk+ver++edp++v++tYeg H+h+
  Neem_23394_f_2  98 LDDGFKWRKYGKKMVKNSPNPRNYYKCSVDGCPVKKRVERDREDPSYVITTYEGVHTHQ 156
                     59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.0E-3484157IPR003657WRKY domain
SuperFamilySSF1182901.57E-2891157IPR003657WRKY domain
PROSITE profilePS5081129.55193158IPR003657WRKY domain
SMARTSM007745.8E-3798157IPR003657WRKY domain
PfamPF031065.3E-2599156IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MSNSNFLPQD SPESDYAEQT NFELSDYLTF DEWSEEEHAS MIFGSVQNPV YRANEVIEPG  60
ASSSHQEGPS NSDSGSGREK KQVKERVAFK TKSEIEILDD GFKWRKYGKK MVKNSPNPRN  120
YYKCSVDGCP VKKRVERDRE DPSYVITTYE GVHTHQSTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-2588155774Probable WRKY transcription factor 4
2lex_A3e-2588155774Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00531DAPTransfer from AT5G26170Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818233e-32LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
GenBankLN7132573e-32LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006474454.14e-91probable WRKY transcription factor 50 isoform X1
RefseqXP_024033930.12e-91probable WRKY transcription factor 50 isoform X1
SwissprotQ8VWQ54e-48WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBLA0A067GDY42e-95A0A067GDY4_CITSI; Uncharacterized protein
TrEMBLV4UPS52e-95V4UPS5_9ROSI; Uncharacterized protein
STRINGXP_006453040.13e-96(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61212747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.12e-50WRKY DNA-binding protein 50
Publications ? help Back to Top
  1. Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D
    DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro.
    Plant Methods, 2010. 6: p. 25
    [PMID:21108821]