PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_23096_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family G2-like
Protein Properties Length: 371aa    MW: 41439.1 Da    PI: 5.2476
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_23096_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like66.74.1e-21178228354
         G2-like   3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54 
                     r++WtpeLH +F  a++ L G +kA Pk il++mk + Lt+ +v+SHLQkY+
  Neem_23096_f_2 178 RIVWTPELHLKFTAAISAL-GDKKARPKLILQMMKEPHLTIRQVASHLQKYK 228
                     99*****************.9******************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011011.465139IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23003.9E-6146No hitNo description
SuperFamilySSF466893.76E-14175233IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-21176234IPR009057Homeodomain-like
TIGRFAMsTIGR015579.1E-18177228IPR006447Myb domain, plants
PfamPF002496.9E-7180228IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MSSVRNRNVA GKALAEGACY FLEKPISFDD LKYIWQHVYK KKSRNPLKES RKSELVHHGK  60
TFQEENIRVN IPNENNNQIM EANQAFTADE ISIKESRNNQ STQQLTANEG NQAFTADEIS  120
IKESRNNQST QQLTANEGKR SLEEGGGGEA KEEKRIKLDS EDDETDENEN FGVKRPRRIV  180
WTPELHLKFT AAISALGDKK ARPKLILQMM KEPHLTIRQV ASHLQKYKGQ VKRISDNGTI  240
DLPSTLKPSR ATCTTGSLPT IKSYEFTVAG TSGSSTNVLN AGKSPIEYFS EGNQEMNVIE  300
VPKPPAGSVL PASSVNQNYE PSSEYADLLK LLDEDEDEEY KSVLGAGLNP CDLDRYCGWL  360
TEALQEDSQL P
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015382697.13e-83putative two-component response regulator-like APRR6
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2005156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68210.14e-17pseudo-response regulator 6