PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_22869_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 197aa    MW: 22139.3 Da    PI: 10.3434
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_22869_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF60.81.6e-1917571151
                    HHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF 11 vtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     t++kRr g+lKKA+ELSvLCd++v +++fs++ kl  ++s
  Neem_22869_f_1 17 LTYTKRRDGLLKKANELSVLCDTDVGLVMFSPSSKLTKFCS 57
                    7*************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.7E-21167IPR002100Transcription factor, MADS-box
PROSITE profilePS5006621.418159IPR002100Transcription factor, MADS-box
SMARTSM004321.6E-26158IPR002100Transcription factor, MADS-box
CDDcd001205.43E-23258No hitNo description
PfamPF003192.8E-171755IPR002100Transcription factor, MADS-box
PRINTSPR004046.0E-132136IPR002100Transcription factor, MADS-box
PRINTSPR004046.0E-133657IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MGRKKLEMKK IEDLSALTYT KRRDGLLKKA NELSVLCDTD VGLVMFSPSS KLTKFCSSGR  60
KEALEKKLIQ LTKQQLRAKE KLSFYQPKVE NITSIHEAHI HEQNISGAIQ HIEKLKDKML  120
GKDSAPRISQ GVEQQAAVSI RDTNFTTDAS ASSKRKRNQV RDANHQAETT STAGLNPSIQ  180
FLDQLRHWIL ESGGHVN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006447462.23e-56agamous-like MADS-box protein AGL66
RefseqXP_006469733.13e-56agamous-like MADS-box protein AGL66
TrEMBLA0A2H5QJ182e-63A0A2H5QJ18_CITUN; Uncharacterized protein
STRINGXP_006469733.11e-55(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.11e-20AGAMOUS-like 104